Skip to product information
1 of 1

Human CD43 Protein, His Tag

Human CD43 Protein, His Tag

Catalog Number: S0A5011 Brand: Starter
Price:
Regular price $194.00 SGD
Regular price Sale price $194.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms Leukosialin, GPL115, Galactoglycoprotein (GALGP), Leukocyte sialoglycoprotein, Sialophorin, SPN
Accession P16150
Amino Acid Sequence

Protein sequence (P16150, Ser20-Arg253, with C-His Tag) STTAVQTPTSGEPLVSTSEPLSSKMYTTSITSDPKADSTGDQTSALPPSTSINEGSPLWTSIGASTGSPLPEPTTYQEVSIKMSSVPQETPHATSHPAVPITANSLGSHTVTGGTITTNSPETSSRTSGAPVTTAASSLETSRGTSGPPLTMATVSLETSKGTSGPPVTMATDSLETSTGTTGPPVTMTTGSLEPSSGASGPQVSSVKLSTMMSPTTSTNASTVPFRNPDENSR

Expression System HEK293
Molecular Weight Predicted MW: 25.1 kDa Observed MW: 40-120 kDa
Purity >90% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Leukosialin also known as sialophorin or CD43 (cluster of differentiation 43) is a transmembrane cell surface protein. Sialophorin (leukosialin) is a major sialoglycoprotein on the surface of human T lymphocytes, monocytes, granulocytes, and some B lymphocytes, which appears to be important for immune function and may be part of a physiologic ligand-receptor complex involved in T-cell activation. Defects in the CD43 molecule are associated with the development of Wiskott–Aldrich syndrome. It also appears in about 25% of intestinal MALTomas. Using immunohistochemistry, CD43 can be demonstrated in the paracortical T-cells of healthy lymph nodes and tonsils; it is also positive in a range of lymphoid and myeloid tumours. Because it stains granulocytes and their precursors, it is an effective marker for myeloid tumours.

Picture

SDS-PAGE

6μg(R: reducing conditions)