Skip to product information
1 of 1

Human ALPI Protein, His tag

Human ALPI Protein, His tag

Catalog Number: S0A0145 Reactivity: Human Conjugation: Unconjugated Brand: Starter
Price:
Regular price $219.00 SGD
Regular price Sale price $219.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms Intestinal-type alkaline phosphatase, IAP, Intestinal alkaline phosphatase
Accession P09923
Amino Acid Sequence

Protein sequence (P09923, Val20-Asp503, with C-His tag) VIPAEEENPAFWNRQAAEALDAAKKLQPIQKVAKNLILFLGDGLGVPTVTATRILKGQKNGKLGPETPLAMDRFPYLALSKTYNVDRQVPDSAATATAYLCGVKANFQTIGLSAAARFNQCNTTRGNEVISVMNRAKQAGKSVGVVTTTRVQHASPAGTYAHTVNRNWYSDADMPASARQEGCQDIATQLISNMDIDVILGGGRKYMFPMGTPDPEYPADASQNGIRLDGKNLVQEWLAKHQGAWYVWNRTELMQASLDQSVTHLMGLFEPGDTKYEIHRDPTLDPSLMEMTEAALRLLSRNPRGFYLFVEGGRIDHGHHEGVAYQALTEAVMFDDAIERAGQLTSEEDTLTLVTADHSHVFSFGGYTLRGSSIFGLAPSKAQDSKAYTSILYGNGPGYVFNSGVRPDVNESESGSPDYQQQAAVPLSSETHGGEDVAVFARGPQAHLVHGVQEQSFVAHVMAFAACLEPYTACDLAPPACTTD

Expression System HEK293
Molecular Weight Predicted MW: 54.1 kDa Observed MW: 65-75 kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag with C-His tag
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Alkaline phosphatase, intestinal also known as ALPI is a type of alkaline phosphatase that in humans is encoded by the ALPI gene. Intestinal alkaline phosphatase is an endogenous protein that plays an essential function in the maintenance of gut homeostasis. The protein is responsible for detoxifying bacterial toxins, dephosphorylating phosphorylated nucleotides, regulating lipid absorption in the intestine, and regulating the microbiome in the intestine. In addition to these functions, intestinal alkaline phosphatase can also modulate bicarbonate secretion and can modulate the pH of the duodenum.

Picture

Bioactivity

Immobilized Human ALPI Protein, His tag at 2 μg/mL (100 μL/well) can bind PLAP+ALPI Recombinant Rabbit mAb (SDT-167-155) (Cat. No. S0B2281) with EC50 of 1.6-2.1 ng/mL.

SDS-PAGE

2μg(R: reducing conditions)