Skip to product information
1 of 1

Human Alpha-synuclein Protein, His tag

Human Alpha-synuclein Protein, His tag

Catalog Number: S0A0027 Reactivity: Human Conjugation: Unconjugated Brand: Starter
Price:
Regular price $111.00 SGD
Regular price Sale price $111.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms Non-A beta component of AD amyloid, Non-A4 component of amyloid precursor (NACP), SNCA, NACP, PARK1
Accession P37840
Amino Acid Sequence

Protein sequence (P37840, Met1-Ala140, with C-His tag) MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA

Expression System E.coli
Molecular Weight Predicted MW: 16.1 kDa Observed MW: 20 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag with C-His tag
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Alpha-synuclein is a neuronal protein that regulates synaptic vesicle trafficking and subsequent neurotransmitter release. It is abundant in the brain, while smaller amounts are found in the heart, muscle and other tissues. In the brain, alpha-synuclein is found mainly in the axon terminals of presynaptic neurons. Within these terminals, alpha-synuclein interacts with phospholipids and proteins. It plays a role in restricting the mobility of synaptic vesicles, consequently attenuating synaptic vesicle recycling and neurotransmitter release. 

Picture

Bioactivity

The ELISA based assay shows that Human Alpha-synuclein Protein, His tag (Cat. No. S0A0027) is stable in the quality of different batches.

SDS-PAGE

2μg(R: reducing conditions)