Skip to product information
1 of 1

Bovine bPAG19 Protein, His tag

Bovine bPAG19 Protein, His tag

Catalog Number: S0A0157 Reactivity: Bovine Conjugation: Unconjugated Brand: Starter
Price:
Regular price $614.00 SGD
Regular price Sale price $614.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Bovine
Synonyms Peptidase A1 domain-containing protein
Accession F1N7M7
Amino Acid Sequence

Protein sequence (F1N7M7, Met1-Val380, with C-His tag) MKWLVVLGLVAFSECIVKIPLRRVKTMRKALSGKNMLNNFLKEHAYRLSQISFRGSNLTSHPLRNIKDLVYLANITIGTPPQEFQVFLDTGSSDLWVPSDFCTSPGCSKHVRFRHLQSSTFRLTNKTFSITYGSGRIKGVVAHDTVRIGDLVSTDQPFSLSMAEYGLEHIPFDGILGLNYPNVSSSGAIPIFDKLKNQGAISEPVFAFYLSKDKQEGSVVMFGGVDHRYYKGKLNWVPLIQAGNWIIHMDSISIERKVIACSGGCVAFVDIGTAFIEGPKPLVDNMQKLIRAKPWRSKHYVSCSAVNTLPSITFTINGINYPVPGRAYILKDSRRRCYSTFKEIPLSPTTEFWMLGDVFLRLYFSVFDRGNDRIGLARAV

Expression System HEK293
Molecular Weight Predicted MW: 44.3 kDa Observed MW: 55-70 kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag with C-His tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Pregnancy-associated glycoproteins (PAGs) belonging to the multigene family encoded by the aspartic protease gene, are a group of specific glycoproteins synthesized and secreted by placental trophoblast giant cells of artiodactyls, which can be detected in the maternal circulation after embryo attachment. It has the potential to serve multiple functions, including embryonic attachment, placental development, pregnancy maintenance, embryo survival, proteolytic activity, and immune regulation, which are most often used as biomarkers for early pregnancy diagnosis and assessment of embryo loss, as well as indicators of evaluation of fetal viability and monitoring placental health.

Picture

SDS-PAGE

2μg(R: reducing conditions)