Skip to product information
1 of 1

Anaplasma marginale mCherry, His tag

Anaplasma marginale mCherry, His tag

Catalog Number: S0A0066 Brand: Starter
Price:
Regular price $91.00 SGD
Regular price Sale price $91.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Anaplasma marginale
Accession X5DSL3
Amino Acid Sequence

Protein sequence (X5DSL3, Met1-Lys236, with N-6*His) MGSSHHHHHHSSGLVPRGSHMVSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYK

Expression System E.coli
Molecular Weight Predicted MW: 28.9 kDaObserved MW: 10, 19, 28.9 kDa
Purity >95% by SDS-PAGE
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/ml according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

mCherry is a member of the mFruits family of monomeric red fluorescent proteins (mRFPs). mCherry absorbs light between 540-590 nm and emits light in the range of 550-650 nm. mCherry, out of all of the true monomers developed, has the longest wavelengths, the highest photostability, fastest maturation, excellent pH resistance, and is closest to mRFP1 in its excitation and emission maxima. mCherry belongs to the group of fluorescent protein chromophores used as instruments to visualize genes and analyze their functions in experiments. mCherry is used in fluorescence microscopy as an intracellular probe. It can also be used as a long-wavelength hetero-FRET (fluorescence resonant energy transfer) acceptor and probe for homo-FRET experiments.

Picture

SDS-PAGE

2μg(R: reducing conditions)