Skip to product information
1 of 1

IgG4 Fc Protein, Human

IgG4 Fc Protein, Human

Catalog Number: UA050002 Application: Isotype control Reactivity: Human Conjugation: Unconjugated Brand: UA BIOSCIENCE
Price:
Regular price $170.00 SGD
Regular price Sale price $170.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms IgG4 Fc;Human IgG4 Fc protein, Ig gamma-4 chain C region, IgG4 Fc
Accession P01861
Amino Acid Sequence ESKYGPPCPSCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK
Expression System HEK293
Molecular Weight 30-32 KDa(Reducing)
Purity >95%, by SDS-PAGE under reducing conditions
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4, 5% trehalose
Reconstitution Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation .
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

Immunoglobulin G4 (IgG4), one of the four human IgG subtypes, is a monomer immunoglobulin mainly involved in secondary antibody reaction, which is produced and secreted by B cells. The IgG tetramer consists of two heavy chains (50 kDa) and two light chains (25 kDa) connected by disulfide bonds, which are two identical halves to form a Y shape. After pepsin cleavage, IgG was divided into two F (ab) s with one antigen binding site and a highly conserved Fc segment. The Fc segment has a highly conserved n-glycosylation site. IgG4 is the least common IgG among healthy adults, accounting for about 5% of the total IgG library. Although the amino acid sequence of IgG4 is about 90% homologous to other IgG subclasses, IgG4 is unique because it is a univalent function with little or no inflammation, and IgG4 Fc can bind to other Fc from all human IgG subclasses. IgG4 is generally considered to be a protective blocking antibody because it can inhibit or prevent inflammation by binding to inflammatory IgG subclasses or IgE competitive antigens. In addition, IgG4 can cause a subset of autoimmune diseases in severe diseases.

Picture

SDS-PAGE

IgG4 Fc, Human ,1μg on SDS-PAGE under reducing condition. The purity is greater than 95%.

RP-HPLC