Skip to product information
1 of 2

IgG3 Fc Protein, Human

IgG3 Fc Protein, Human

Catalog Number: UA050005 Application: Isotype control Reactivity: Human Conjugation: Unconjugated Brand: UA BIOSCIENCE
Price:
Regular price $130 USD
Regular price Sale price $130 USD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms Ig gamma-3 chain C region,IgG3 Fc
Accession P01860
Amino Acid Sequence ELKTPLGDTTHTCPRCPEPKSCDTPPPCPRCPEPKSCDTPPPCPRCPEPKSCDTPPPCPRCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFKWYVDGVEVHNAKTKPREEQYNSTFRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESSGQPENNYNTTPPMLDSDGSFFLYSKLTVDKSRWQQGNIFSCSVMHEALHNRFTQKSLSLSPGK
Expression System HEK293
Molecular Weight 35-43 kDa(Reducing)
Purity >95%, by SDS-PAGE under reducing conditions
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation .
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

Immunoglobulin G (IgG) is a monomer immunoglobulin, mainly involved in secondary antibody reaction, plasma B cell synthesis and secretion, constitute 75% of human serum immunoglobulin. There are four subtypes of IgG antibody: IgG1, IgG2, IgG3 and IgG4, which decrease in turn in serum. The spatial structure of these four subtypes is similar and the heavy chain sequences of each subtype are highly homologous. IgG3 has an extended hinge region, and its core hinge region has 11 disulfide bonds, so it is unstable for protease cleavage. After pepsin cleavage, IgG3 is divided into two antigen binding sites F (ab) s and a highly conserved Fc segment, and the Fc segment has a highly conserved N-glycosylation site. Fc fragments have been shown to mediate phagocytosis, trigger inflammation, and target IgG to specific tissues. The binding ability of IgG3 to Fc γ Rs was the strongest, and the effects of ADCC, ADCP and CDC were stronger than that of IgG1.

Picture

Bioactivity

Anti-His antibody Immobilized on CM5 Chip captured Fc γ RIIa/CD32a(H167) His tag, Human (Cat. No. UA020002), can bind IgG3 Fc, Human (UA050005) with an affinity constant of 4.27μM as determined in SPR assay.

SDS-PAGE

IgG3 Fc, Human,1μg on SDS-PAGE under reducing and Non-reducing condition. The purity is greater than 95%.

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)