Skip to product information
1 of 1

IgG2b Fc Protein, Llama

IgG2b Fc Protein, Llama

Catalog Number: UA050004 Application: Isotype control Reactivity: Camelid Conjugation: Unconjugated Brand: UA BIOSCIENCE
Price:
Regular price $168.00 SGD
Regular price Sale price $168.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species llama
Synonyms Ig gamma-2 chain C region,IgG2B Fc
Accession AAX73259.1
Amino Acid Sequence EPKTPKPQPQPQPQPNPTTESKCPKCPAPELLGGPSVFIFPPKPKDVLSISGRPEVTCVVVDVGQEDPEVSFNWYIDGAEVRTANTRPKEEQFNSTYRVVSVLPIQHQDWLTGKEFKCKVNNKALPAPIEKTISKAKGQTREPQVYALAPHREELAKDTVSVTCLVKGFYPPDINVEWQRNRQPEPEGTYATTPPQLDNDGTYFLYSKLSVGKNTWQRGETFTCVVMHETLHNHYTQKSISQS
Expression System HEK293
Molecular Weight 35-40kDa(Reducing)
Purity >95%, by SDS-PAGE under reducing conditions
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation .
Stability & Storage

· 12 months from date of receipt, -20 to -70 °C as supplied. 
· 6 months, -20 to -70 °C under sterile conditions after reconstitution.
· 1 week, 2 to 8 °C under sterile conditions after reconstitution.  
· Please avoid repeated freeze-thaw cycles.

Background

Immunoglobulin G (IgG) is a kind of monomer immunoglobulin which is developed and secreted by effective B cells and participates in secondary antibody reaction. IgG has four subclasses (IgG1,IgG2,IgG3,IgG4). IgG2 contains two members: IgG2a and IgG2b, both of which belong to the Fc fragments of IgG antibodies. Fc fragments have been shown to mediate phagocytosis, trigger inflammation, and target immunoglobulin Ig to specific tissues. In addition, some studies have shown that protein G or protein An on the surface of some staphylococci and Streptococcus strains can also specifically bind to the Fc region.

Picture

SDS-PAGE

IgG2b Fc, Llama,1μg on SDS-PAGE under reducing and Non-reducing condition. The purity is greater than 95%.