Skip to product information
1 of 1

IgG2a Fc (Glu98-Lys330) Protein, Mouse

IgG2a Fc (Glu98-Lys330) Protein, Mouse

Catalog Number: UA050010 Application: Isotype control Reactivity: Mouse Conjugation: Unconjugated Brand: UA BIOSCIENCE
Price:
Regular price $366.00 SGD
Regular price Sale price $366.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Mouse
Synonyms IgG2A
Accession P01863
Amino Acid Sequence

Glu98-Lys330 EPRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLTCMVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGK

Expression System HEK293
Molecular Weight 29-33kDa (Reducing)
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag No Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4.
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1.Hock, Goddard, MacPherson et al.Levels and in vitro functional effects of circulating anti-hinge antibodies in melanoma patients receiving the immune checkpoint inhibitor pembrolizumab. PLoS One (2023) 18 (9), e0290793.

Background

Immunoglobulin G2 (IgG2) is a member of many immunoglobulin G developed and secreted by effective B cells. In wake of cutting by pepsin, IgG is divided into two F(ab)s with one antigen binding site and a high conserved Fc segment. The Fc segment bears a highly conserved N-glycosylation site. Some studies have shown that mIgG2a has a greater effect compared with mIgG1 and mIgE in controlling tumor growth in a therapeutic setting.

Picture

SDS-PAGE

1μg (R: reducing condition, N: non-reducing condition).

RP-HPLC