Skip to product information
1 of 1

IgG1 Fc Protein, Mouse

IgG1 Fc Protein, Mouse

Catalog Number: UA050003 Application: Isotype control Reactivity: Mouse Conjugation: Unconjugated Brand: UA BIOSCIENCE
Price:
Regular price $170.00 SGD
Regular price Sale price $170.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Mouse
Synonyms Ig gamma-1 chain C region;IGHG1
Accession AAK53870.1
Amino Acid Sequence VPEVSSVFIFPPKPKDVLTITLTPKVTCVVVDISKDDPEVQFSWFVDDVEVHTAQTQPREEQFNSTFRSVSELPIMHQDWLNGKEFKCRVNSAAFPAPIEKTISKTKGRPKAPQVYTIPPPKEQMAKDKVSLTCMITDFFPEDITVEWQWNGQPAENYKNTQPIMDTDGSYFVYSKLNVQKSNWEAGNTFTCSVLHEGLHNHHTEKSLSHSPGK
Expression System HEK293
Molecular Weight 28-31 kDa(Reducing)
Purity >95%, by SDS-PAGE under reducing conditions
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

Immunoglobulin G (IgG) is a monomer immunoglobulin, mainly involved in secondary antibody reaction, plasma B cell synthesis and secretion, constitute 75% of human serum immunoglobulin. There are four subtypes of human IgG antibodies: IgG1,IgG2,IgG3,IgG4; mice IgG can be divided into five subtypes; IgG1,IgG2A,IgG2B,IgG2C and IgG3; rats have four subtypes: IgG1,IgG2A,IgG2B and IgG2C. The nomenclature of IgG subtypes of different species is independent, so there is no correlation among different genera. The content of IgG1 in serum accounts for about 60%, and the half-life in serum is about 21 days. After pepsin cleavage, IgG1 is divided into two antigenic binding sites F (ab) s and a highly conserved Fc fragment, and Fc has a highly conserved N-glycosylation site. IgG1 is the most potential subtype in tumor immunotherapy. The active form of IgG1 is bivalent monomer, and human IgG1 can also bind to mouse Fc γ receptor, so the obvious effect can be observed in mouse model.

Picture

SDS-PAGE

IgG1 Fc, Mouse,1μg on SDS-PAGE under reducing and Non-reducing condition. The purity is greater than 95%.