Skip to product information
1 of 2

Siglec-15 His Tag Protein, Mouse

Siglec-15 His Tag Protein, Mouse

Catalog Number: UA010613 Reactivity: Mouse Conjugation: Unconjugated Brand: UA BIOSCIENCE
Price:
Regular price $783.00 SGD
Regular price Sale price $783.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Mouse
Synonyms Sialic acid binding Ig-like lectin 15, SIGLEC-I
Accession A7E1W8
Amino Acid Sequence

Arg24-Thr262, with C-terminal 10 * His RRDASGDLLNTEAHSAPAQRWSMQVPAEVNAEAGDAAVLPCTFTHPHRHYDGPLTAIWRSGEPYAGPQVFRCTAAPGSELCQTALSLHGRFRLLGNPRRNDLSLRVERLALADSGRYFCRVEFTGDAHDRYESRHGVRLRVTAAAPRIVNISVLPGPAHAFRALCTAEGEPPPALAWSGPAPGNSSAALQGQGHGYQVTAELPALTRDGRYTCTAANSLGRAEASVYLFRFHGAPGTSTGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight

35-40kDa

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage

· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.

· 3 months, -20 to -80℃ under sterile conditions after reconstitution.

· 1 week, 2 to 8℃ under sterile conditions after reconstitution.

· Please avoid repeated freeze-thaw cycles.

Reference

1.Wang J. et al. (2019) Siglec-15 as an immune suppressor and potential target for normalization cancer immunotherapy, Nature Medicine. 25: 656-666.

Background

Siglec-15 is a critical immune suppressor with broad upregulation on various cancer types and a potential target for cancer immunotherapy. Siglec-15 has unique molecular features compared with many other known checkpoint inhibitory ligands. It shows prominent expression on macrophages and cancer cells and a mutually exclusive expression with PD-L1. As a new player in the cancer immunotherapeutic arena, Siglec-15 may represent a novel class of immune inhibitors with tumor-associated expression and divergent mechanisms of action to PD-L1, with potential implications in anti-PD-1/PD-L1-resistant patients. Siglecs are cell surface proteins that bind sialic acid. They are found primarily on the surface of immune cells and are a subset of the I-type lectins. Siglec-15 consisting of immunoglobulin (Ig)-like domains, transmembrane domain and a short cytoplasmic tail. Siglec-15 is that recognizes sialylated glycans and regulates osteoclast differentiation. Siglec-15 is a potential therapeutic target for osteoporosis and plays a conserved regulatory role in the immune system of vertebrates.

Picture

SDS-PAGE

1μg (R: reducing conditions, N: non-reducing conditions).

ELISA

Immobilized Siglec-15 His Tag Protein, Mouse (Cat. No. UA010613) at 2.0μg/mL (100μL/well) can bind Siglec-15 Rabbit pAb (A18660)  with EC50 of 69.15-98.58 ng/mL.