Skip to product information
1 of 3

LAG-3/CD223 His Tag Protein, Human

LAG-3/CD223 His Tag Protein, Human

Catalog Number: UA010102 Reactivity: Human Conjugation: Unconjugated Brand: UA BIOSCIENCE
Price:
Regular price $695.00 SGD
Regular price Sale price $695.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Accession P18627
Amino Acid Sequence

Leu23-Leu450, with C-terminal 8*His LQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPGAQRSGRAPGALPAGHLHHHHHHHH

Expression System HEK293
Molecular Weight 55-65kDa (Reducing)
Purity

>95% by SDS-PAGE

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

Lymphocyte-activation protein 3 belongs to Ig superfamily and contains 4 extracellular Ig-like domains. The LAG3 gene contains 8 exons. The sequence data, exon/intron organization, and chromosomal localization all indicate a close relationship of LAG3 to CD4. The LAG3 is Biased expression in spleen (RPKM 15.1), lymph node (RPKM 8.3) and 12 other tissues. Lymphocyte activation gene 3 (LAG3) is an inhibitory checkpoint protein expressed on activated T effector, T regulatory, and natural killer cells. The main function of LAG3 is the regulation of immune homeostasis.Several studies have suggested its role in malignant and autoimmune diseases.

Picture

Bioactivity

Immobilized LAG-3/CD223 His Tag, Human (Cat. No. UA010102) at 1.5μg/mL (100μL/well) can bind FGL1 Fc Chimera, Human (Cat. No. UA010251) with EC50 of 0.29-0.38μg/ml.
Immobilized LAG-3/CD223 His Tag, Human (Cat. No. UA010102) at 1.0μg/mL (100μL/well) can bind FGL1 Fc Chimera, Cynomolgus (Cat. No. UA010248) with EC50 of 0.36-0.56μg/ml.

SDS-PAGE

2μg (R: reducing conditions, N: non-reducing conditions).