Skip to product information
1 of 1

IL-12 R beta 1 His Tag Protein, Human

IL-12 R beta 1 His Tag Protein, Human

Catalog Number: UA010373 Reactivity: Human Conjugation: Unconjugated Brand: UA BIOSCIENCE
Price:
Regular price $360 USD
Regular price Sale price $360 USD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms IL-12 R beta 1, CD212, IMD30, IL12RB
Accession P42701
Amino Acid Sequence

Cys24-Glu540, with C-terminal 8* His CRTSECCFQDPPYPDADSGSASGPRDLRCYRISSDRYECSWQYEGPTAGVSHFLRCCLSSGRCCYFAAGSATRLQFSDQAGVSVLYTVTLWVESWARNQTEKSPEVTLQLYNSVKYEPPLGDIKVSKLAGQLRMEWETPDNQVGAEVQFRHRTPSSPWKLGDCGPQDDDTESCLCPLEMNVAQEFQLRRRQLGSQGSSWSKWSSPVCVPPENPPQPQVRFSVEQLGQDGRRRLTLKEQPTQLELPEGCQGLAPGTEVTYRLQLHMLSCPCKAKATRTLHLGKMPYLSGAAYNVAVISSNQFGPGLNQTWHIPADTHTEPVALNISVGTNGTTMYWPARAQSMTYCIEWQPVGQDGGLATCSLTAPQDPDPAGMATYSWSRESGAMGQEKCYYITIFASAHPEKLTLWSTVLSTYHFGGNASAAGTPHHVSVKNHSLDSVSVDWAPSLLSTCPGVLKEYVVRCRDEDSKQVSEHPVQPTETQVTLSGLRAGVAYTVQVRADTAWLRGVWSQPQRFSIEGGGSHHHHHHHH

Expression System HEK293
Molecular Weight 74-84kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1、Oppmann B. et al. (2000) Novel p19 protein engages IL-12p40 to form a cytokine, IL-23, with biological activities similar as well as distinct from IL-12. Immunity. 13(5): 715-725.

2、Robinson R T. IL12Rbeta1: the cytokine receptor that we used to know. Cytokine. 2015;71(2): 348-359.

Background

The human IL-12 R subunit is a member of the cytokine receptor superfamily. The IL-12 R beta (IL-12Rβ) gene is located on chromosome 19p13 and has 17 exons. The receptor is composed of two subunits—IL-12Rβ1 and IL-12Rβ2—and is a member of the gp130 cytokine receptor superfamily. IL-12R are located mainly on T cells and NK cells, and stimulate TH1 and NK cell growth, while inhibiting TH2 cell responses. IL-12Rβ1 encodes the β1 chain common to the receptors for IL-12 and IL-23. Human IL-12Rβ1 is an autosomal gene that is essential for mycobacterial disease resistance and T cell differentiation. Mutations in the IL-12Rβ1 gene accounts for 38% of cases of MSMD. IL12Rβ1 is a cell surface receptor that binds the IL12p40 domain of IL12/IL23, and cooperates with co-receptors IL12Rβ2 or IL23R to initiate intracellular STAT signaling.

Picture

SDS-PAGE

1μg (R: reducing conditions, N: non-reducing conditions).

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)