Skip to product information
1 of 1

Frizzled-10/FZD10 His Tag Protein, Human

Frizzled-10/FZD10 His Tag Protein, Human

Catalog Number: UA010551 Reactivity: Human Conjugation: Unconjugated Brand: UA BIOSCIENCE
Price:
Regular price $543.00 SGD
Regular price Sale price $543.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Antigen EPCR/PROCR
Synonyms CD350 antigen, CD350, frizzled (Drosophila) homolog 10, frizzled homolog 10 (Drosophila), Frizzled10, Frizzled-10, Fz10, FZ-10, FZD10, FzE7, hFz10
Accession Q9ULW2
Amino Acid Sequence

Ile21-Gly161, with C-terminal 8*His ISSMDMERPGDGKCQPIEIPMCKDIGYNMTRMPNLMGHENQREAAIQLHEFAPLVEYGCHGHLRFFLCSLYAPMCTEQVSTPIPACRVMCEQARLKCSPIMEQFNFKWPDSLDCRKLPNKNDPNYLCMEAPNNGSDEPTRGGGGSHHHHHHHH

Expression System HEK293
Molecular Weight 19-24kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1. Cell Signal . 2006 Jul;18(7):934-41. Epub 2006 Feb 9.

Background

Frizzled-10 (FZD10), also known as CD350, is a G-protein coupled receptor with seven transmembrane domains. The 205 amino acid N-terminal extracellular region of Frizzled-10 contains a cysteine-rich domain that comprises the Wnt binding domain and mediates receptor oligomerization. Most of frizzled receptors are coupled to the beta-catenin canonical signaling pathway, which leads to the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin and activation of Wnt target genes. Frizzled-10 is also up-regulated in several cancers and transformed cell lines. It may be involved in transduction and intercellular transmission of polarity information during tissue morphogenesis and differentiation.

Picture

SDS-PAGE

1μg (R: reducing conditions, N: non-reducing conditions).