Skip to product information
1 of 3

FOLR1 Fc Chimera Protein, Human

FOLR1 Fc Chimera Protein, Human

Catalog Number: UA010117 Reactivity: Human Conjugation: Unconjugated Brand: UA BIOSCIENCE
Price:
Regular price $835.00 SGD
Regular price Sale price $835.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Accession P15328
Amino Acid Sequence

Arg25-Met233, with C-terminal Human IgG Fc RAWARTNVCMNAKHHKKGDKHCRWRKNACCSTNTSAHKDVSYYRNWNHCGMAACKRHDTCYCSNGWVDSWRKRVNVCKDCWWDCRTSYTCKSNWHKGWNWTSGNKCAVGAACHYTTVCNWTHSYKVSNYSRGSGRCMWDAGNNVARYAAAMGGGSGGGSKSSDKTHTCCAGGSVKKDTMSRTVTCVVVDVSHDVKNWYVDGVVHNAKTKRYNSTYRVVSVTVHDWNGKYKCKVSNKAAKTSKAKGRVYTSRDTKNVSTCVKGYSDAVWSNGNNYKTTVDSDGSYSKTVDKSRWGNVSCSVMHAHNHYTKSSSGK

Expression System HEK293
Molecular Weight

60-68kDa (Reducing)

Purity

>95% by SDS-PAGE

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

A biomarker of recent interest in the cancer field is folate receptor alpha (FOLR1), a membrane-bound protein with high affinity for binding and transporting folate into cells.  FOLR1 is a glycosyl phosphatidylinositol connected membrane glycoprotein, consisting of 257 amino acids. The FOLR1 gene is formed of seven exons and 2 independent tissue-specific promoters, promoter 1 (P1) at the exon 1 and promoter 4 (P4) at the exon 4 whose utilization is tissue-specific. The gene is located on chromosome 11q13.3-14.1. The protein is completely exposed to extracellular molecules and anchored at the cell membrane by GPI. FOLR1 is involved in DNA replication and damage repair. FOLR1 mediates cellular responses to folate, including cell division, proliferation, and tissue growth. Overexpression of FOLR1 may confer a growth advantage to tumors by increasing folate uptake and/or may affect cell proliferation via alternative cell signaling pathways. FOLR1 levels have been found to be elevated in tumors of epithelial origin compared to normal tissue, including ovarian, breast, brain, lung and colorectal cancers. FOLR1 protein expression was lowest in normal ovarian tissue, higher in benign ovarian tumors, and highest in malignant tumors. Folate receptor alpha (FOLR1) has been identified as a potential prognostic and therapeutic target in a number of cancers.

Picture

Bioactivity

Immobilized Folic acid-BSA at 2.0μg/mL (100μL/well) can bind FOLR1 Fc Chimera, Human (Cat. No. UA010117) with EC50 of 0.046-0.054μg/ml.

SDS-PAGE

2μg (R: reducing conditions, N: non-reducing conditions).

ELISA

Immobilized FOLR1 Fc Chimera, Human  (Cat. No. UA010117) at 2.0μg/mL (100μL/well) can bind Biotinylated Anti-Human FOLR1 (Mirvetuximab)  with EC50 of 3.61-5.90ng/mL.