Skip to product information
1 of 1

DMBT1 His Tag Protein, Human

DMBT1 His Tag Protein, Human

Catalog Number: UA010667 Reactivity: Human Conjugation: Unconjugated Brand: UA BIOSCIENCE
Price:
Regular price $789.00 SGD
Regular price Sale price $789.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms GP340 Protein, muclin
Accession Accession#:Q9UGM3-2
Amino Acid Sequence

Thr20-Ser220, with C-terminal 8*His TGGWIPRTTDYASLIPSEVPLDPTVAEGSPFPSESTLESTVAEGSPISLESTLESTVAEGSLIPSESTLESTVAEGSDSGLALRLVNGDGRCQGRVEILYRGSWGTVCDDSWDTNDANVVCRQLGCGWAMSAPGNAWFGQGSGPIALDDVRCSGHESYLWSCPHNGWLSHNCGHGEDAGVICSAAQPQSTLRPESWPVRISGGGSHHHHHHHH

Expression System HEK293
Molecular Weight 35-50kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1. Review Int J Mol Sci . 2010;11(12):5212-33. Epub 2010 Dec 17.

Background

DMBT1(missing in malignant brain tumor 1), also known as glycoprotein 340 and salivary agglutinin, is a secreted protein that belongs to the DMBT1 family. DMBT1 is highly expressed in alveolar and macrophage tissues. In some macrophages, expression is visible on the membrane, while in other macrophages, it is strongly expressed in the phagosome/phagolysosomal chamber. It is expressed in the lungs, trachea, salivary glands, small intestine and stomach. In the pancreas, it is expressed in certain cells on the island of Langerhans. DMBT1 plays an important role in innate immune response.Recent studies identify DMBT1 as a high affinity ligand of Siglec-8 in human airways.

Picture

SDS-PAGE

2μg (R: reducing conditions, N: non-reducing conditions).