Skip to product information
1 of 4

Biotinylated IL-4R alpha/CD124 Avi&His Tag Protein, Human

Biotinylated IL-4R alpha/CD124 Avi&His Tag Protein, Human

Catalog Number: UA010671 Reactivity: Human Conjugation: Biotin Brand: UA BIOSCIENCE
Price:
Regular price $731.00 SGD
Regular price Sale price $731.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms IL4R, CD124, IL4RA
Accession P24394
Amino Acid Sequence

Met26-His232, with C-terminal Avi Tag&His Tag MKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRLLYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEHVKPRAPGNLTVHTNVSDTLLLTWSNPYPPDNYLYNHLTYAVNIWSENDPADFRIYNVTYLEPSLRIAASTLKSGISYRARVRAWAQCYNTTWSEWSPSTKWHNSYREPFEQHGGGSGLNDIFEAQKIEWHEHHHHHHHH

Expression System HEK293
Molecular Weight

40-50kDa

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Biotin
Tag Avi Tag, His Tag
Physical Appearance Lyophilized Powder
Storage Buffer

PBS, pH7.4

Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage

· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.

· 3 months, -20 to -80℃ under sterile conditions after reconstitution.

· 1 week, 2 to 8℃ under sterile conditions after reconstitution.

· Please avoid repeated freeze-thaw cycles.

Reference

1. Keats Nelms, THE IL-4 RECEPTOR: Signaling Mechanisms and Biologic Functions. Annu. Rev. Immunol. 1999. 17:701–38.

Background

IL-4Rα is a member of the hematopoietin receptor superfamily. Among the defining features of the members of this superfamily of receptors are shared structural motifs in the extracellular region, which consists of type III fibronectin domains. These motifs include conserved paired Cys residues and, in the membrane proximal region, a WSXWS motif. The latter has been proposed to be required for maintaining the receptor in a conformation favorable to cytokine binding. Structural alterations in the IL-4Rα extracellular region may result in altered receptor signaling capabilities. Indeed, a variant of the human IL-4Rα chain containing a Ile50Val substitution was isolated from atopic individuals and has been shown to enhance signal transduction resulting in the increased production of IgE.

Picture

SDS-PAGE

1μg (R: reducing conditions, N: non-reducing conditions).

ELISA

Immobilized IL-4, Human (Cat. No. UA040026) at 1.5μg/mL (100μL/well) can bind Biotinylated IL-4R alpha/CD124 Avi&His Tag, Human (Cat. No. UA010671) with EC50 of 12.51-16.32ng/mL.

Immobilized Biotinylated IL-4R alpha/CD124 Avi&His Tag, Human (Cat. No. UA010671) at 2.0μg/mL (100μL/well) can bind Dupilumab (Cat. No. UA010946) with EC50 of 5.78-7.91 ng/mL.

Immobilized IL-4 Protein, Human (Cat. No. UA040026) at 5.0μg/mL (100μL/well) can bind Biotinylated IL-4R alpha/CD124 Avi&His Tag Protein, Human (Cat. No. UA010671) with EC50 of 27.67-45.87ng/mL.