Skip to product information
1 of 3

R-Spondin 1(21-146) Protein, Human

R-Spondin 1(21-146) Protein, Human

Catalog Number: UA040022 Reactivity: Human Conjugation: Unconjugated Brand: UA BIOSCIENCE
Price:
Regular price $201.00 SGD
Regular price Sale price $201.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Antigen R-Spondin 1
Synonyms RSPO1,CRISTIN3,FLJ40906,RP11-566C13.1,R-spondin-1
Accession Q2MKA7-1
Amino Acid Sequence

Ser21-Ala146, with C-terminal 8*His SRGIKGKRQRRISAEGSQACAKGCELCSEVNGCLKCSPKLFILLERNDIRQVGVCLPSCPPGYFDARNPDMNKCIKCKIEHCEACFSHNFCTKCKEGLYLHKGRCYPACPEGSSAANGTMECSSPAGGGSHHHHHHHH

Expression System HEK293
Molecular Weight

17-25kDa (Reducing)

Purity

>95% by SDS-PAGE

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

The R-Spondin proteins comprise a family of secreted proteins, known for their important roles in cell proliferation, differentiation and death, by inducing the Wnt pathway. Several studies have demonstrated the importance of RSPOs in regulation of a number of tissue-specific processes, namely: bone formation, skeletal muscle tissue development, proliferation of pancreatic β-cells and intestinal stem cells and even cancer. RSPO1 stands out among RSPOs molecules with respect to its potential therapeutic use, especially in the Regenerative Medicine field,due to its mitogenic activity in stem cells. Here, we generated a recombinant human RSPO1 (rhRSPO1) using the HEK293 cell line, obtaining a purified, characterized and biologically active protein product to be used in Cell Therapy.

Picture

Bioactivity

Measured by its ability to induce Topflash reporter activity in HEK293T human embryonic kidney cells.
The EC50 for this effect is less than 20ng/mL in the presence of 5ng/mL Recombinant Human Wnt‑3a.

SDS-PAGE

2μg (R: reducing conditions, N: non-reducing conditions).

SPR

RNF43 mFc Chimera, Mouse (Cat. No. UA010216) captured on Protein A Biosenor, can bind RSPO1(21-146) His Tag, Human (Cat. No. UA040022) with an affinity constant of 6.73nM as determined in SPR assay.