Skip to product information
1 of 1

Human TSLP Protein, His tag

Human TSLP Protein, His tag

Catalog Number: S0A0169 Reactivity: Human Conjugation: Unconjugated Brand: Starter
Price:
Regular price $261.00 SGD
Regular price Sale price $261.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms Thymic stromal lymphopoietin
Accession Q969D9
Amino Acid Sequence

Protein sequence (Q969D9, Try29-Gln159, with C-His tag) YDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ

Expression System HEK293
Molecular Weight Predicted MW: 16.6 kDa Observed MW: 17-25 kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag with C-His tag
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Thymic stromal lymphopoietin (TSLP) is a cytokine that plays a vital role in the immune system. It was first discovered in the thymus and is mainly produced by stromal cells. TSLP functions as a key mediator in initiating and regulating immune responses. It activates dendritic cells, which then stimulate the differentiation of T helper cells, especially Th2 cells. This leads to the release of various inflammatory cytokines, contributing to the development of allergic and inflammatory diseases. In addition, TSLP is involved in immune responses against certain pathogens. Its dysregulation has been associated with several immune - related disorders, making it an important target for therapeutic interventions in diseases like asthma and atopic dermatitis.

Picture

Bioactivity

Immobilized Human TSLP Protein, his tag at 2 μg/mL (100 μL/well) can bind Recombinant Human TSLP R (C-Fc) with EC50 of 2.8-3.6 ng/ml.

SDS-PAGE

2μg(R: reducing conditions)