Skip to product information
1 of 2

VSIG3/IGSF11 His Tag Protein, Human

VSIG3/IGSF11 His Tag Protein, Human

Catalog Number: UA010564 Reactivity: Human Conjugation: Unconjugated Brand: UA BIOSCIENCE
Price:
Regular price $752.00 SGD
Regular price Sale price $752.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Antigen VSIG3/IGSF11
Synonyms VSIG3, IgSF11, CXADRL1, Bt-IgSF, CT119
Accession Q5DX21-1
Amino Acid Sequence

Leu23-Gly241, with C-terminal 8*His LEVSESPGSIQVARGQPAVLPCTFTTSAALINLNVIWMVTPLSNANQPEQVILYQGGQMFDGAPRFHGRVGFTGTMPATNVSIFINNTQLSDTGTYQCLVNNLPDIGGRNIGVTGLTVLVPPSAPHCQIQGSQDIGSDVILLCSSEEGIPRPTYLWEKLDNTLKLPPTATQDQVQGTVTIRNISALSSGLYQCVASNAIGTSTCLLDLQVISPQPRNIGGGGSHHHHHHHH

Expression System HEK293
Molecular Weight

32-35kDa

Purity >95% by SDS-PAGE
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer

PBS, pH7.4

Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage

· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.

· 3 months, -20 to -80℃ under sterile conditions after reconstitution.

· 1 week, 2 to 8℃ under sterile conditions after reconstitution.

· Please avoid repeated freeze-thaw cycles.

Reference

1. Suzu S, Hayashi Y, Harumi T, Nomaguchi K, Yamada M, Hayasawa H, et al. Molecular cloning of a novel immunoglobulin superfamily gene preferentially expressed by brain and testis. Biochem Biophys Res Commun (2002) 296(5):1215-21.

Background

VSIG3 (V-set and immunoglobulin domain containing 3) is a member of the immunoglobulin superfamily (IgSF), which is also called the immunoglobulin superfamily 11 gene (IgSF11), and it is highly expressed in the brain and testis. Mature human VSIG3 consists of a 219 amino acid (aa) extracellular domain (ECD) that contains two tandem Ig-like domains, a 21 aa transmembrane segment, and a 169 aa cytoplasmic domain. The function of VSIG3 is to stimulate cell growth through homophilic interactions. In clinical, the VSIG3 has been reported to as a novel target for cancer immunotherapy of gastrointestinal and hepatocellular carcinomas. In addition, VSIG-3 is also a ligand of B7 family member VISTA/PD-1H and inhibits human T-cell functions through a novel VSIG-3/VISTA pathway.

Picture

SDS-PAGE

1μg (R: reducing conditions, N: non-reducing conditions).

SPR

Protein A Chip captured B7-H5/VISTA Fc Chimera Protein, Human (Cat. No. UA010061), can bind VSIG3/IGSF11 His Tag Protein, Human (Cat. No. UA010564) with an affinity constant of 5.26μM as determined in SPR assay.