Skip to product information
1 of 1

VHL His&AVI Tag Protein, Human

VHL His&AVI Tag Protein, Human

Catalog Number: UA070007 Reactivity: Human Conjugation: Unconjugated Brand: UA BIOSCIENCE
Price:
Regular price $1,357.00 SGD
Regular price Sale price $1,357.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms HRCA1 Protein, Human; pVHL Protein, Human; RCA1 Protein, Human; VHL1 Protein, Human
Amino Acid Sequence

Met1-Asp213, with N-terminal His SUMO & C-terminal AVI Tag

MGSSHHHHHHSSGLVPRGSHMASMSDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGGMPRRAENWDEAEVGAEEAGVEEYGPEEDGGEESGAEESGPEESGPEELGAEEEMEAGRPRPVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQERIAHQRMGDGLNDIFEAQKIEWHE

Expression System E.coli
Molecular Weight 45 kDa
Purity

>85% by SDS-PAGE

Endotoxin <1EU/μg
Conjugation Unconjugated
Tag Avi Tag, His Tag
Physical Appearance Liquid
Storage Buffer 20 mM PB,100 mM KCl,0.1 mM EDTA ,2 mM DTT, pH 7.5
Reconstitution A hardcopy of datasheet with reconstitution instructions is sent along with the products. Please refer to it for detailed information.
Stability & Storage

· 12 months from date of receipt, -20 to -70 °C as supplied. 
· 6 months, -20 to -70 °C under sterile conditions after reconstitution.
· 1 week, 2 to 8 °C under sterile conditions after reconstitution.  
· Please avoid repeated freeze-thaw cycles.

Picture

SDS-PAGE

1μg (R: reducing condition, N: non-reducing condition).