Skip to product information
1 of 2

UMP-CMP kinase/CMPK1 His Tag Protein, Human

UMP-CMP kinase/CMPK1 His Tag Protein, Human

Catalog Number: UA070016 Reactivity: Human Conjugation: Unconjugated Brand: UA BIOSCIENCE
Price:
Regular price $509.00 SGD
Regular price Sale price $509.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms CK, CMK, CMPK, UMK, UMP-CMPK, UMPK
Accession P30085
Amino Acid Sequence

Met1-Gly196, with N-terminal 8*His HHHHHHHHGGGSMKPLVVFVLGGPGAGKGTQCARIVEKYGYTHLSAGELLRDERKNPDSQYGELIEKYIKEGKIVPVEITISLLKREMDQTMAANAQKNKFLIDGFPRNQDNLQGWNKTMDGKADVSFVLFFDCNNEICIERCLERGKSSGRSDDNRESLEKRIQTYLQSTKPIIDLYEEMGKVKKIDASKSVDEVFDEVVQIFDKEG

Expression System Baculovirus-InsectCells
Molecular Weight 26-29kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Liquid
Storage Buffer 20mM Tris, 500mM NaCl,10%Glycerol, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied; 6 months, -20 to -70 °C under sterile conditions after reconstitution; 1 week, 2 to 8 °C under sterile conditions after reconstitution; Please avoid repeated freeze-thaw cycles.

Reference

1、Liou J. et al. (2004) Phosphorylation of Cytidine, Deoxycytidine, and Their Analog Monophosphates by Human UMP/CMP Kinase is Differentially Regulated by ATP and Magnesium. Molecular Pharmacology. 67(3): 806-14.

2、Gerhard D S. et al. (2004) The Status, Quality, and Expansion of the NIH Full-Length cDNA Project: The Mammalian Gene Collection (MGC). Genome Research. 14(10B): 2121-7.

3、Segura-Pena D, et al. (2004) Substrate-induced Conformational Changes in Human UMP/CMP Kinase. Journal of Biological Chemistry. 279(32): 33882-9.

Background

Pyrimidine nucleoside monophosphate kinase [UMP/CMP kinase (UMP/CMPK)] (CMPK1) is also named as CMK, CMPK, UCK, UMK, UMPK and belongs to the adenylate kinase family. The gene of encodes one of the enzymes required for cellular nucleic acid biosynthesis. CMPK1 plays an important role in de novo pyrimidine nucleotide biosynthesis. This enzyme catalyzes the transfer of a phosphate group from ATP to CMP, UMP, or dCMP, to form the corresponding diphosphate nucleotide. Alternate splicing results in both coding and non-coding transcript variants. CMPK1 has been reported as a prognostic marker for non-small cell lung cancer, pancreatic cancer and breast cancer. It has 3 isoforms with the molecular mass of 22, 16 and 26 kDa. The longest deduced protein contains 228 amino acids and has a calculated molecular mass of 26 kD.

Picture

Bioactivity

When UMP-CMP kinase/CMPK1 His Tag, Human is immobilized at 0.2µg/mL, it binds to rabbit anti UMP-CMP kinase pAb with an EC50 of 0.010 to 0.013µg/ml.

SDS-PAGE

2μg (R: reducing conditions).