Product Details
Product Details
Product Specification
| Species | Human |
| Synonyms | CK, CMK, CMPK, UMK, UMP-CMPK, UMPK |
| Accession | P30085 |
| Amino Acid Sequence | Met1-Gly196, with N-terminal 8*His HHHHHHHHGGGSMKPLVVFVLGGPGAGKGTQCARIVEKYGYTHLSAGELLRDERKNPDSQYGELIEKYIKEGKIVPVEITISLLKREMDQTMAANAQKNKFLIDGFPRNQDNLQGWNKTMDGKADVSFVLFFDCNNEICIERCLERGKSSGRSDDNRESLEKRIQTYLQSTKPIIDLYEEMGKVKKIDASKSVDEVFDEVVQIFDKEG |
| Expression System | Baculovirus-InsectCells |
| Molecular Weight | 26-29kDa |
| Purity | >95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Liquid |
| Storage Buffer | 20mM Tris, 500mM NaCl,10%Glycerol, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | 12 months from date of receipt, -20 to -70 °C as supplied; 6 months, -20 to -70 °C under sterile conditions after reconstitution; 1 week, 2 to 8 °C under sterile conditions after reconstitution; Please avoid repeated freeze-thaw cycles. |
| Reference |
1、Liou J. et al. (2004) Phosphorylation of Cytidine, Deoxycytidine, and Their Analog Monophosphates by Human UMP/CMP Kinase is Differentially Regulated by ATP and Magnesium. Molecular Pharmacology. 67(3): 806-14. 2、Gerhard D S. et al. (2004) The Status, Quality, and Expansion of the NIH Full-Length cDNA Project: The Mammalian Gene Collection (MGC). Genome Research. 14(10B): 2121-7. 3、Segura-Pena D, et al. (2004) Substrate-induced Conformational Changes in Human UMP/CMP Kinase. Journal of Biological Chemistry. 279(32): 33882-9. |
Background
Pyrimidine nucleoside monophosphate kinase [UMP/CMP kinase (UMP/CMPK)] (CMPK1) is also named as CMK, CMPK, UCK, UMK, UMPK and belongs to the adenylate kinase family. The gene of encodes one of the enzymes required for cellular nucleic acid biosynthesis. CMPK1 plays an important role in de novo pyrimidine nucleotide biosynthesis. This enzyme catalyzes the transfer of a phosphate group from ATP to CMP, UMP, or dCMP, to form the corresponding diphosphate nucleotide. Alternate splicing results in both coding and non-coding transcript variants. CMPK1 has been reported as a prognostic marker for non-small cell lung cancer, pancreatic cancer and breast cancer. It has 3 isoforms with the molecular mass of 22, 16 and 26 kDa. The longest deduced protein contains 228 amino acids and has a calculated molecular mass of 26 kD.
Picture
Picture
Bioactivity

SDS-PAGE

