Skip to product information
1 of 5

ACVR2B Fc Chimera Protein, Human

ACVR2B Fc Chimera Protein, Human

Catalog Number: UA010213 Reactivity: Human Conjugation: Unconjugated Brand: UA BIOSCIENCE
Price:
Regular price $618.00 SGD
Regular price Sale price $618.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms ACVR2B, Activin Receptor Type-2B, ACTRIIB, MGC116908
Accession Q13705
Amino Acid Sequence

Ser19-Thr134, with C-terminal Human IgG Fc

SGRGEAETRECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLPEAGGPEVTYEPPPTAPTIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Expression System HEK293
Molecular Weight

56-70kDa

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage

· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.

· 3 months, -20 to -80℃ under sterile conditions after reconstitution.

· 1 week, 2 to 8℃ under sterile conditions after reconstitution.

· Please avoid repeated freeze-thaw cycles.

Reference

1、Attisano L. et al. (1996) Activation of signalling by the activin receptor complex. Mol Cell Biol. 16(3): 1066-1073.

2、Woodruff T K. et al. (1998) Regulation of cellular and system function by activin. Biochem Pharmacol. 55(7): 953-963.

Background

Activin proteins that belong to the transforming growth factor-beta (TGF-β) superfamily, exert their biological actions by binding to heteromeric receptor complexes of type I and type II serine/threonine kinase receptors. On ligand binding, type I and II receptors form a stable complex, resulting in phosphorylation of type I receptors by type II receptors with constitutive kinase activity, and subsequently initiates the activation of downstream molecules including the endogenous Smads. ActRIIB, also known as ActRIIB, is a type II receptor containing an extracellular domain (ECD), a transmembrane segment, and a cytoplasmic region that includes the kinase domain. ActRIIB is a receptor for activin A, activin B and inhibin A. Multiple ActRIIB isoforms can also be generated, which bind activin isoforms with different affinities.

Picture

SDS-PAGE

1μg (R: reducing conditions, N: non-reducing conditions).

ELISA

Immobilized Activin A Protein, Human (Cat. No. UA040343) at 1.0μg/mL (100μL/well) can bind ACVR2B Fc Chimera, Human (Cat. No. UA010213)  with EC50 of 9.27-13.85ng/mL.

Immobilized Activin A Protein, Human (Cat. No. UA040178) at 1.0μg/mL (100μL/well) can bind ACVR2B Fc Chimera, Human (Cat. No. UA010213)  with EC50 of 6.69-11.23ng/mL.

SPR

CM5 Chip captured Activin A Protein, Human/Mouse/Rat (Cat. No. UA040343), can bind ACVR2B Fc Chimera, Human (Cat. No. UA010213) with an affinity constant of 18.28nM as determined in SPR assay.

CM5 Chip captured Activin A Protein, Human (Cat. No. UA040178), can bind ACVR2B Fc Chimera, Human (Cat. No. UA010213) with an affinity constant of 12.40nM as determined in SPR assay.