Skip to product information
1 of 3

TNF-α Protein, Human

TNF-α Protein, Human

Catalog Number: UA040062 Reactivity: Human Conjugation: Unconjugated Brand: UA BIOSCIENCE
Price:
Regular price $121.00 SGD
Regular price Sale price $121.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms TNF-α, Cachectin, Tumor Necrosis Factor-Alpha, TNFSF1A
Accession P01375
Amino Acid Sequence

Val77-Leu233, with N-terminal 8*His MHHHHHHHHVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL

Expression System E.coli
Molecular Weight

18.5kDa

Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer

20mM Tris, 150mM NaCl, 2mM TCEP, pH8.5

Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage

· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.

· 3 months, -20 to -80℃ under sterile conditions after reconstitution.

· 1 week, 2 to 8℃ under sterile conditions after reconstitution.

· Please avoid repeated freeze-thaw cycles.

Reference

1、Hector J. et al. (2007) TNF-alpha alters visfatin and adiponectin levels in human fat. Horm Metab Res. 39(4): 250-255.

2、Berthold-Losleben M. et al. (2008) The TNF-alpha System: Functional Aspects in Depression, Narcolepsy and Psychopharmacology. Curr Neuropharmacol. 6(3): 193-202.

Background

Tumor necrosis factor α (TNF alpha) is an effective pro-inflammatory cytokine, which can kill and inhibit tumor cells. It is mainly produced by activated macrophages and can also be secreted by other types of cells, such as CD4+ lymphocytes, NK cells, neutrophils, mast cells, eosinophils and neuronal tissues. The members of TNF alpha family exert their cellular effect through two distinct surface receptors of the TNF receptor family, TNFR1 and TNFR2. The pleiotropic biological effects of TNF can be attributed to its ability to simultaneously activate multiple signaling pathways in cells. TNF-induced NF-κB activation promotes the growth, invasion and metastasis of cancer cells.

Picture

Western Blot

Primary antibody: Phospho-NF-κB p65 (Ser536) Recombinant Rabbit mAb at 1/1000 dilution

Lane 1: HeLa treated with 100 ng/ml Calyculin A for 30 minutes, whole cell lysate 20 µg

Lane 2: HeLa treated with 100 ng/ml Calyculin A for 30 minutes and 20 ng/ml TNF-α for 5 minutes whole cell lysate 20 µg

Secondary antibody: Goat Anti-rabbit IgG, (H+L), HRP conjugated at 1/10000 dilution

Predicted MW: 60 kDa

Observed MW: 65 kDa

Bioactivity

Measured in a cell proliferation assay using L-929 mouse fibrosarcoma cells, the EC50 for this effect is less than 0.12 ng/ml.

SDS-PAGE

1μg (R: reducing condition, N: non-reducing condition).