Skip to product information
1 of 1

Human YWHAE/14-3-3 epsilon Protein, His Tag

Human YWHAE/14-3-3 epsilon Protein, His Tag

Catalog Number: S0A0210 Brand: Starter
Price:
Regular price $100 USD
Regular price Sale price $100 USD
Size:

For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms 14-3-3 protein epsilon, 14-3-3E
Accession P62258
Amino Acid Sequence

Protein sequence (P62258, Met1-Gln255, with C-His Tag) MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGEEQNKEALQDVEDENQ

Expression System E.coli
Molecular Weight Predicted MW: 30.9 kDaObserved MW: 32 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

YWHAE, also known as 14-3-3ε, is a member of the highly conserved 14-3-3 protein family. These proteins function as key regulatory molecules by binding to phosphorylated serine and threonine residues on a vast array of client proteins. Through these interactions, YWHAE modulates critical cellular processes including signal transduction, cell cycle control, apoptosis, and metabolism. It acts as a molecular scaffold, influencing the activity, localization, and stability of its binding partners. Its gene location within the 17p13.3 chromosomal region implicates it in human diseases; deletions encompassing YWHAE are associated with Miller-Dieker syndrome, a severe neuronal migration disorder, highlighting its essential role in brain development. YWHAE is dysregulated in various cancers, underscoring its importance in cellular proliferation and survival pathways.

Picture

SDS-PAGE

2μg(R: reducing conditions)