Skip to product information
1 of 1

Human Factor H/CFH (860-1231aa) Protein, His Tag

Human Factor H/CFH (860-1231aa) Protein, His Tag

Catalog Number: S0A0217 Brand: Starter
Price:
Regular price $100 USD
Regular price Sale price $100 USD
Size:

For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms Complement factor H, H factor 1, HF, HF1, HF2
Accession P08603
Amino Acid Sequence

Protein sequence (P08603, Ser860-Arg1231, with C-His Tag) SIPLCVEKIPCSQPPQIEHGTINSSRSSQESYAHGTKLSYTCEGGFRISEENETTCYMGKWSSPPQCEGLPCKSPPEISHGVVAHMSDSYQYGEEVTYKCFEGFGIDGPAIAKCLGEKWSHPPSCIKTDCLSLPSFENAIPMGEKKDVYKAGEQVTYTCATYYKMDGASNVTCINSRWTGRPTCRDTSCVNPPTVQNAYIVSRQMSKYPSGERVRYQCRSPYEMFGDEEVMCLNGNWTEPPQCKDSTGKCGPPPPIDNGDITSFPLSVYAPASSVEYQCQNLYQLEGNKRITCRNGQWSEPPKCLHPCVISREIMENYNIALRWTAKQKLYSRTGESVEFVCKRGYRLSSRSHTLRTTCWDGKLEYPTCAKR

Expression System HEK293
Molecular Weight Predicted MW: 43.4 kDa Observed MW: 55-70 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Complement Factor H (CFH) is a critical regulatory glycoprotein of the innate immune system's complement cascade, specifically the alternative pathway. Produced primarily in the liver, it circulates in the blood and is also synthesized locally by various cell types, including retinal pigment epithelial cells. Its essential function is to protect host tissues from inappropriate complement-mediated attack. CFH acts as a cofactor for the inactivation of C3b, accelerates the decay of the C3 convertase enzyme complex, and binds to host cell surfaces. This binding is crucial for distinguishing "self" from "non-self," preventing damage to healthy human cells. Dysregulation or deficiency of CFH is strongly linked to several diseases, most notably age-related macular degeneration (AMD) and atypical hemolytic uremic syndrome (aHUS).

Picture

SDS-PAGE

2μg(R: reducing conditions)