Skip to product information
1 of 1

Siglec-3/CD33 His Tag Protein, Cynomolgus

Siglec-3/CD33 His Tag Protein, Cynomolgus

Catalog Number: UA010402 Reactivity: Cynomolgus Conjugation: Unconjugated Brand: UA BIOSCIENCE
Price:
Regular price $794.00 SGD
Regular price Sale price $794.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Cynomolgus
Synonyms Siglec-3, CD33, gp67
Accession XP_045235686.1
Amino Acid Sequence Met16-Gly248, with C-terminal 8*His MDPRVRLEVQESVTVQEGLCVLVPCTFFHPVPYHTRNSPVHGYWFREGAIVSLDSPVATNKLDQEVQEETQGRFRLLGDPSRNNCSLSIVDARRRDNGSYFFRMEKGSTKYSYKSTQLSVHVTDLTHRPQILIPGALDPDHSKNLTCSVPWACEQGTPPIFSWMSAAPTSLGLRTTHSSVLIITPRPQDHGTNLTCQVKFPGAGVTTERTIQLNVSYASQNPRTDIFLGDGSGGGGSHHHHHHHH
Expression System HEK293
Molecular Weight 40-50kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1、Ulyanova T. et al. (1999) The sialoadhesin CD33 is a myeloid-specific inhibitory receptor. Eur J Immunol. 29(11): 3440-9.

2、Freeman S D. et al. (1995) Characterization of CD33 as a new member of the sialoadhesin family of cellular interaction molecules. Blood. 85(8): 2005-12.

Background

Sialic acid-binding immunoglobulin-like lectins (Siglecs)1 are transmembrane sialic acid-binding proteins of the immunoglobulin (Ig) superfamily characterized by the presence of an N-terminal V-set Ig-like domain and variable numbers of C2 set domains (1). The first Siglecs to be characterized were Siglec-1, Siglec-2, Siglec-3 and myelin-associated Siglec-4 which share ∼25–30% sequence identity within the extracellular regions. Recent studies have uncovered the existence of a cluster of genes on human chromosome 19q13.3-4 that encode novel Siglecs highly related to CD33. This CD33-related subgroup includes Siglecs-3, -5, -6, -7, and -8, each of which share ∼50–70% sequence identity. These differences in expression and ligand binding suggest that each Siglec mediates a specific, nonredundant function in hemopoietic cell biology. CD33 (siglec-3) is the smallest siglec member. It preferentially binds to α2-6- and α2-3-sialylated glycans and strongly binds to sialylated ligands on leukemic cell line. Recently, the C1q complement system component has been established as a soluble ligand for CD33. CD33 is mainly expressed in the surface of human leukocytes of the myeloid lineage; however, it is important to note that it can also be expressed on lymphoid cells, including NK cells at several differentiation stages. Human CD33 is expressed on the cell membrane as two isoforms, CD33M, the full-length protein, and CD33m, lacking the V extracellular domain. The CD33 expression level has been recently related to Alzheimer’s disease pathology, autoimmune diseases such as systemic lupus erythematosus (SLE), type II diabetes, or infection.

Picture

SDS-PAGE

1μg (R: reducing condition, N: non-reducing condition).