Skip to product information
1 of 3

FOLR1 His Tag Protein, Human

FOLR1 His Tag Protein, Human

Catalog Number: UA010050 Reactivity: Human Conjugation: Unconjugated Brand: UA BIOSCIENCE
Price:
Regular price $824.00 SGD
Regular price Sale price $824.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Accession P15328
Amino Acid Sequence

Arg25-Met233, with C-terminal 8*His RIAWARTELLNVCMNAKHHKEKPGPEDKLHEQCRPWRKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMAPACKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERVLNVPLCKEDCEQWWEDCRTSYTCKSNWHKGWNWTSGFNKCAVGAACQPFHFYFPTPTVLCNEIWTHSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAAAMGGGSHHHHHHHH

Expression System HEK293
Molecular Weight 35-42 kDa(Reducing)
Purity

>95% by SDS-PAGE

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

Folate receptor alpha (FOLR1), a member of the folate receptor family, is a secreted protein that either anchors to membranes via a glycosyl-phosphatidylinositol linkage or exists in a soluble form with high affinity for binding folate and its reduced derivatives into cells and transport 5-methyltetrahydrofolate into cells. Folate is a necessary component of cell metabolism. Overexpression of FOLR1 may confer a growth advantage to tumors by increasing folate uptake and/or may affect cell proliferation via alternative cell signaling pathways. In healthy individuals, FOLR1 expression is often limited to the apical surfaces of epithelium in the lung, kidney and choroid plexus but is overexpressed in a variety of solid tumours such as ovarian cancer, non-small cell lung cancer, breast cancer, kidney cancer and high-grade osteosarcoma. 

Picture

SDS-PAGE

1 μg (R: reducing conditions, N: non-reducing conditions).

ELISA

Immobilized Folic acid-BSA at 5.0μg/mL (100μL/well) can bind FOLR1 His Tag, Human (Cat. No. UA010050) with EC50 of 0.44-0.58μg/ml.

Immobilized FOLR1 His Tag, Human (Cat. No. UA010050) at 2.0μg/mL (100μL/well) can bind Anti-Human FOLR1 Monoclonal Antibody (Mirvetuximab) with EC50 of 1.06-1.51ng/mL.