Skip to product information
1 of 2

B7-H3/CD276 His Tag Protein, Cynomolgus

B7-H3/CD276 His Tag Protein, Cynomolgus

Catalog Number: UA010629 Reactivity: Cynomolgus Conjugation: Unconjugated Brand: UA BIOSCIENCE
Price:
Regular price $400 USD
Regular price Sale price $400 USD
Size:

For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Cynomolgus
Synonyms B7H3, B7-H3, CD276 antigen, CD276 molecule, CD276, B7H34Ig-B7-H3, B7-H3B7 homolog 3, Costimulatory molecule
Accession XP_015308534.1
Amino Acid Sequence

Leu29-Glu465, with C-terminal 10*His LEVQVPEDPVVALVGTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYANRTALFLDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGAPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSITITPQRSPTGAVEVQVPEDPVVALVGTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYANRTALFLDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGAPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFPPEGGGSGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight

68-85kDa

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1. Liu J. et al. (2021) Targeting B7-H3 via chimeric antigen receptor T cells and bispecific killer cell engagers augments antitumor response of cytotoxic lymphocytes. J Hematol Oncol. 14(1): 21.

Background

B7-h3 (B7 homolog 3 protein), also known as CD276, is an important immune checkpoint molecule in the B7-CD28 family. It is a type I transmembrane glycoprotein consisting of 316 amino acids and contains a putative 28AA signal peptide, a 217AA extracellular region composed of immunoglobulin constant (IgC) and variable (IgV) structures, a transmembrane region, and a 45-amino acid cytoplasmic domain. B7-H3 is a T cell co-suppressor molecule with partial co-stimulatory function. B7-H3 can effectively inhibit the function of T cells and NK cells, and also play a role in bone development. The expression of B7-H3 is low in normal tissues and is found in a variety of malignant tumors, which is closely related to the growth, metastasis, recurrence and poor prognosis of malignant tumors. B7-H3 can down-regulate T-assisted type 1 mediated immune response, inhibit CD4+T cell activation and inhibit cytokine production, and thus may play a role in promoting immune escape of cancer cells.

Picture

SDS-PAGE

2μg (R: reducing condition, N: non-reducing condition).

ELISA

Immobilized B7-H3/CD276 His Tag, Cynomolgus (Cat. No. UA010629) at 2.0μg/mL (100μL/well) can bind Anti-Human B7-H3 Monoclonal Antibody (Enoblituzumab) with EC50 of 1.98-2.54 ng/mL.