1 μg (R: reducing conditions, N: non-reducing conditions).
TREM2 Fc Chimera Protein, Human
TREM2 Fc Chimera Protein, Human
Price:
Regular price
$560 USD
Regular price
Sale price
$560 USD
Unit price
per
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details
Product Details
Product Details
Product Specification
| Species | Human |
| Antigen | TREM2 |
| Synonyms | TREM-2, Triggering receptor expressed on monocytes 2 |
| Accession | Q9NZC2-1 |
| Amino Acid Sequence | His19-Ser174, with C-terminal Human IgG1 Fc HNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSISRSLLEGEIPFPPTSIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
| Expression System | HEK293 |
| Molecular Weight | 55-60kDa |
| Purity | ＞95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | Human Fc |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
| Reference | 1. Deczkowska A, Weiner A, Amit I. The physiology, pathology, and potential therapeutic applications of the TREM2 signaling pathway. Cell. (2020) 181:1207-17. 10.1016/j.cell.2020.05.003 2. Guerreiro R, Wojtas A, Bras J, Carrasquillo M, Rogaeva E, Majounie E, et al.. TREM2 variants in Alzheimer's disease. N Engl J Med. (2013) 368:117-27. 10.1056/NEJMoa1211851 3. Molgora M, Esaulova E, Vermi W, Hou J, Chen Y, Luo J, et al.. TREM2 modulation remodels the tumor myeloid landscape enhancing Anti-PD-1 immunotherapy. Cell. (2020) 182:886-900.e817. 10.1016/j.cell.2020.07.013. |
Background
Triggering receptor expressed on myeloid cells-2 (TREM2) is a transmembrane receptor of the immunoglobulin superfamily and a crucial signaling hub for multiple pathological pathways that mediate immunity. Expressed in the brain, specifically in microglia and in the fusiform gyrus. TREM2 can inhibit the phagocytic function of dendritic cells and macrophages, thereby affecting related immune signaling pathways. TREM2 has vital roles in Alzheimer's disease and other neurodegenerative diseases, and is involved in numerous immune and inflammatory pathways that contribute to the etiology of these diseases. TREM2 has been studied widely in microglia, where TREM2 functions in neuronal debris clearance to counteract the inflammatory response. TREM2 can alter the morphology of tumor-infiltrating macrophages, inhibit tumor growth, and enhance checkpoint blocking therapy. TREM2 can function as a prognostic marker in various malignant tumors because of its role in tumorigenesis and tumor immunity.
Picture
Picture
SDS-PAGE
ELISA
Immobilized Apolipoprotein E/APOE4 His Tag, Human (Cat. No. UA030062) at 2.0μg/mL (100μL/well) can bind TREM2 Fc Chimera, Human (Cat. No. UA010593) with EC50 of 2.08-3.22ng/ml.
