Skip to product information
1 of 1

Mouse CCL2/JE/MCP-1 Protein, His tag

Mouse CCL2/JE/MCP-1 Protein, His tag

Catalog Number: S0A4060 Brand: Starter
Price:
Regular price $350 USD
Regular price Sale price $350 USD
Size:

For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Mouse
Synonyms C-C motif chemokine 2, Monocyte chemoattractant protein 1, Monocyte chemotactic protein 1 (MCP-1), Platelet-derived growth factor-inducible protein JE, Small-inducible cytokine A2, Je, Mcp1, Scya2
Accession P10148
Amino Acid Sequence

Protein sequence (P10148, Gln24-Asn148, with C-His tag) QPDAVNAPLTCCYSFTSKMIPMSRLESYKRITSSRCPKEAVVFVTKLKREVCADPKKEWVQTYIKNLDRNQMRSEPTTLFKTASALRSSAPLNVKLTRKSEANASTTFSTTTSSTSVGVTSVTVN

Expression System HEK293
Molecular Weight

Predicted MW: 15.5 kDaObserved MW: 27-40 kDa

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag with C-His Tag
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

The chemokine (C-C motif) ligand 2 (CCL2) is a small cytokine that belongs to the CC chemokine family. CCL2 tightly regulates cellular mechanics and thereby recruits monocytes, memory T cells, and dendritic cells to the sites of inflammation produced by either tissue injury or infection. CCL2 is implicated in pathogeneses of several diseases characterized by monocytic infiltrates, such as psoriasis, rheumatoid arthritis and atherosclerosis. CCL2 is involved in the neuroinflammatory processes that takes place in the various diseases of the central nervous system (CNS), which are characterized by neuronal degeneration. CCL2 expression in glial cells is increased in epilepsy, brain ischemia Alzheimer's disease experimental autoimmune encephalomyelitis (EAE), and traumatic brain injury.

Picture

SDS-PAGE

2 μg(R: reducing conditions)