Skip to product information
1 of 1

JAM-C His Tag Protein, Mouse

JAM-C His Tag Protein, Mouse

Catalog Number: UA010507 Reactivity: Mouse Conjugation: Unconjugated Brand: UA BIOSCIENCE
Price:
Regular price $604 USD
Regular price Sale price $604 USD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Mouse
Antigen JAM-C
Synonyms CD323; JAM-2; JAM3; JAMC; JAM-C; JAM-CFLJ14529; junctional adhesion molecule 3JAM-3; junctional adhesion molecule C
Accession Accession#: Q9D8B7
Amino Acid Sequence

Glu30-Asn241, with C-terminal 8*His EAVNLKSSNRNPVVHEFESVELSCIITDSQTSDPRIEWKKIQDGQTTYVYFDNKIQGDLAGRTDVFGKTSLRIWNVTRSDSAIYRCEVVALNDRKEVDEITIELIVQVKPVTPVCRIPAAVPVGKTATLQCQESEGYPRPHYSWYRNDVPLPTDSRANPRFQNSSFHVNSETGTLVFNAVHKDDSGQYYCIASNDAGAARCEGQDMEVYDLNGGGSHHHHHHHH

Expression System HEK293
Molecular Weight 30-35kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1.Chavakis, T. et al. (2003) Thromb. Haemost. 89:13.2.Aurrand-Lions, M. et al. (2001) Blood 98:3699.3.Spermatid differentiation requires the assembly of a cell polarity complex downstream of junctional adhesion molecule-C.Gliki G., Ebnet K., Aurrand-Lions M., Imhof B.A., Adams R.H.4.Antibody against junctional adhesion molecule-C inhibits angiogenesis and tumor growth.Lamagna C., Hodivala-Dilke K.M., Imhof B.A., Aurrand-Lions M.

Background

The family of junctional adhesion molecules (JAM), comprised of at least three members, are type I transmembrane receptors belonging to the immunoglobulin (Ig) superfamily. These proteins are localized in the tight junctions between endothelial cells or epithelial cells. Some family members are also found on blood leukocytes and platelets. Junctional adhesion protein that mediates heterotypic cell-cell interactions with its cognate receptor JAM2 to regulate different cellular processes. Plays a role in homing and mobilization of hematopoietic stem and progenitor cells within the bone marrow. At the surface of bone marrow stromal cells, it contributes to the retention of the hematopoietic stem and progenitor cells expressing JAM3. Plays a central role in leukocytes extravasation by facilitating transmigration through the endothelium. Plays a role in spermatogenesis where JAM2 and JAM3, which are respectively expressed by Sertoli and germ cells, mediate an interaction between both cell types and play an essential role in the anchorage of germ cells onto Sertoli cells and the assembly of cell polarity complexes during spermatid differentiation. Also functions as a counter-receptor for ITGAM, mediating leukocyte-platelet interactions and is involved in the regulation of transepithelial migration of polymorphonuclear neutrophils (PMN).

Picture

SDS-PAGE

2μg (R: reducing condition, N: non-reducing condition).

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)