Product Details
Product Details
Product Specification
Species | Mouse |
Synonyms | IL-15RA, IL-15R-alpha, Interleukin-15 Receptor Subunit Alpha, CD215 |
Accession | Q60819 |
Amino Acid Sequence | Gly33-Lys205, with C-terminal Human IgG1 Fc GTTCPPPVSIEHADIRVKNYSVNSRERYVCNSGFKRKAGTSTLIECVINKNTNVAHWTTPSLKCIRDPSLAHYSPVPTVVTPKVTSQPESPSPSAKEPEAFSPKSDTAMTTETAIMPGSRLTPSQTTSAGTTGTGSHKSSRAPSLAATMTLEPTASTSLRITEISPHSSKMTKIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
Expression System | HEK293 |
Molecular Weight | 60-85kDa |
Purity | >95% by SDS-PAGE |
Endotoxin | <0.1EU/μg |
Conjugation | Unconjugated |
Tag | Human Fc Tag |
Physical Appearance | Lyophilized Powder |
Storage Buffer | PBS, pH7.4 |
Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
Stability & Storage |
· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
Reference | 1、Perrier C. et al. (2013) Interleukin-15 receptor α expression in inflammatory bowel disease patients before and after normalization of inflammation with infliximab. Immunology. 138(1): 47-56. |
Background
IL-15Ra chain is expressed by many cell types including monocytes, dendritic cells, natural killer cells, T cells and fibroblasts. Several isoforms of IL-15Ra exist and are generated either by alternative splicing or by proteolytic cleavage. Hence, IL-15Ra can be found as a membrane receptor or as a soluble receptor (sIL-15Ra); and as most isoforms of the receptor contain a sushi domain allowing very-high-affinity binding of IL-15, signaling or regulatory functions can be attributed to the receptor. Competition between soluble and membrane receptors can result in reduced biological activity of IL-15, though a super agonist effect of the soluble form was also observed. The signaling of IL-15 appears more complicated than for other cytokines because IL-15 primarily exists as a complex bound to IL-15Ra. When IL-15/IL-15Ra complexes are shuttled to the cell surface, they can stimulate opposing cells through the b/cC receptor complex (trans-presentation), or alternatively may allow an autocrine stimulation (cis-presentation).
Picture
Picture
SDS-PAGE

ELISA

Immobilized IL-15, Human (Cat. No. UA040010) at 2μg/mL (100μL/well) can bind IL-15R alpha/CD215 Fc Chimera, Mouse (Cat. No. UA010314) with EC50 of 18.40-68.11 ng/ml.

