Skip to product information
1 of 1

Human PSCA Protein, hFc tag

Human PSCA Protein, hFc tag

Catalog Number: S0A6046 Reactivity: Human Conjugation: Unconjugated Brand: Starter
Price:
Regular price $335 USD
Regular price Sale price $335 USD
Size:

For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms Prostate stem cell antigen
Accession O43653
Amino Acid Sequence

Protein sequence (O43653, Leu12-Ser86, with C-hFc tag) LLCYSCKAQVSNEDCLQVENCTQLGEQCWTARIRAVGLLTVISKGCSLNCVDDSQDYYVGKKNITCCDTDLCNAS

Expression System HEK293
Molecular Weight Predicted MW: 34.3 kDa Observed MW: 43-55 kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag with C-hFc tag
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Prostate stem cell antigen is a glycosylphosphatidylinositol-anchored cell membrane glycoprotein. In addition to being highly expressed in the prostate it is also expressed in the bladder, placenta, colon, kidney, and stomach. It is up-regulated in a large proportion of prostate cancers and is also detected in cancers of the bladder and pancreas. The ligand activating PSCA or the downstream physiological role has not yet been determined, because of its mechanism and over expression in prostate cancer cells, PSCA can potentially serve as a biomarker for detecting cancer.

Picture

SDS-PAGE

2μg(R: reducing conditions)