Skip to product information
1 of 2

Human Galectin-3, His tag

Human Galectin-3, His tag

Catalog Number: S0A6024 Brand: Starter
Price:
Regular price $100 USD
Regular price Sale price $100 USD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms Gal-3, 35 kDa lectin, Carbohydrate-binding protein 35 (CBP 35), Galactose-specific lectin 3, Galactoside-binding protein (GALBP), IgE-binding protein, L-31, Laminin-binding protein, Lectin L-29, Mac-2 antigen, LGALS3, MAC2
Accession P17931
Amino Acid Sequence

Protein sequence(P17931, Met1-Ile250, with C-10*His)
MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMIGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical:27.8kDa Actual:35kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Galectin-3 is a member of the lectin family, of which 14 mammalian galectins have been identified. Galectin-3 is approximately 30 kDa and, like all galectins, contains a carbohydrate-recognition-binding domain (CRD) of about 130 amino acids that enable the specific binding of β-galactosides. Galectin-3 (Gal-3) is also a member of the beta-galactoside-binding protein family that plays an important role in cell-cell adhesion, cell-matrix interactions, macrophage activation, angiogenesis, metastasis, apoptosis. Galectin-3 is increasingly being used as a diagnostic marker for different cancers. It can be screened for and used as a prognostic factor to predict the progression of the cancer. Galectin-3 has varying effects in different types of cancer. One approach to cancers with high galectin-3 expression is to inhibit galectin-3 to enhance treatment response.

Picture

Bioactivity

Immobilized Human Galectin-3, His tag at 1 μg/mL (50 μL/well) can bind Galectin-3 Recombinant Rabbit mAb (SDT-370-111) (S0B2197) with EC50 of 6.802-9.746 ng/ml.

SDS-PAGE

1μg(R: reducing conditions)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)