Skip to product information
1 of 2

Human CD81 , His tag

Human CD81 , His tag

Catalog Number: S0A1020 Brand: Starter
Price:
Regular price $185 USD
Regular price Sale price $185 USD
Size:

For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms 26 kDa cell surface protein TAPA-1, Target of the antiproliferative antibody 1, Tetraspanin-28 (Tspan-28), TAPA1, TSPAN28
Accession P60033
Amino Acid Sequence

Protein sequence(P60033, Phe113-Lys201, with C-10*His) FVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKGGGGSHHHHHHHHHH

Expression System CHO
Molecular Weight Theoretical:11.4kDa Actual:10kDa
Purity >95% by SDS-PAGE
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

CD81 is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. It is a cell surface glycoprotein that is known to complex with integrins. This protein appears to promote muscle cell fusion and support myotube maintenance. Also it may be involved in signal transduction. Studies showed that this protein plays a critical role in Hepatitis C attachment and/or cell entry by interacting with virus' E1/E2 glycoproteins heterodimer. It also appears to play a role in liver invasion by Plasmodium species. Meanwhile, CD81 is required for Plasmodium vivax sporozoite entry into human hepatocytes and for Plasmodium yoelii sporozoite entry into murine hepatocytes.

Picture

Bioactivity

Immobilized Human CD81, His Tag at 2 μg/mL (50 μL/well) can bind CD81 Recombinant Rabbit mAb (SDT-144-22) (S0B0053) with EC50 of 18.68-24.35 ng/ml.

SDS-PAGE

2μg(R: reducing conditions)