2μg（R: reducing conditions）
Human CD58, His tag
Human CD58, His tag
Price:
Regular price
$176.00 SGD
Regular price
Sale price
$176.00 SGD
Unit price
per
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details
Product Details
Product Details
Product Specification
| Species | Human |
| Synonyms | Surface glycoprotein LFA-3, LFA3 |
| Accession | P19256 |
| Amino Acid Sequence | Protein sequence (P19256, Phe29-Arg215, with C-10*His) FSQQIYGVVYGNVTFHVPSNVPLKEVLWKKQKDKVAELENSEFRAFSSFKNRVYLDTVSGSLTIYNLTSSDEDEYEMESPNITDTMKFFLYVLESLPSPTLTCALTNGSIEVQCMIPEHYNSHRGLIMYSWDCPMEQCKRNSTSIYFKMENDLPQKIQCTLSNPLFNTTSSIILTTCIPSSGHSRHRGGGGSHHHHHHHHHH |
| Expression System | HEK293 |
| Molecular Weight | Predicted MW: 23.1 kDa Observed MW: 33-55 kDa |
| Purity | ＞95% by SDS-PAGE |
| Tag | with C-10*His |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4. |
| Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. |
| Stability & Storage | 12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles. |
Background
CD58, or lymphocyte function-associated antigen 3 (LFA-3), is a cell adhesion molecule expressed on APCs, particularly macrophages, and other tissue cells. CD58 binds to CD2 (LFA-2) on T cells and is important in strengthening the adhesion and recognition between the T cells and Professional Antigen Presenting Cells, facilitating signal transduction necessary for an immune response. Polymorphisms in the CD58 gene are associated with increased risk for multiple sclerosis. Genomic region containing the single-nucleotide polymorphism rs1335532, associated with high risk of multiple sclerosis, has enhancer properties and can significantly boost the CD58 promoter activity in lymphoblast cells. CD58 plays a role in the regulation of colorectal tumor-initiating cells (CT-ICs). Thus, cells that express CD58 have become a cell of interest in tumorigenesis. Mutations of CD58 have been linked to immune evasion observed in some lymphomas and studies are underway to analyze how its involvement directly affects classical Hodgkin lymphoma (cHL).
Picture
Picture
SDS-PAGE
