• Product image media
  • Product image media
1 2

Galectin-9 His Tag Protein, Human

Galectin-9 His Tag Protein, Human

Catalog Number: UA010431 Reactivity: Human Conjugation: Unconjugated Brand: UA BIOSCIENCE
Share:
Price:
$642 USD
$642 USD
Size:

For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Antigen Galectin-9
Synonyms Gal-9, Ecalectin, Tumor antigen HOM-HD-21
Accession O00182-2
Amino Acid Sequence

Ala2-Thr323, with N-terminal 8* His

HHHHHHHHAFSGSQAPYLSPAVPFSGTIQGGLQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAFHFNPRFEDGGYVVCNTRQNGSWGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFVQYFHRVPFHRVDTISVNGSVQLSYISFQPPGVWPANPAPITQTVIHTVQSAPGQMFSTPAIPPMMYPHPAYPMPFITTILGGLYPSKSILLSGTVLPSAQRFHINLCSGNHIAFHLNPRFDENAVVRNTQIDNSWGSEERSLPRKMPFVRGQSFSVWILCEAHCLKVAVDGQHLFEYYHRLRNLPTINRLEVGGDIQLTHVQT
Expression System HEK293
Molecular Weight

47-55kDa (Reducing)
Purity

＞95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1.Iwasaki-Hozumi H., Chagan-Yasutan H., Ashino Y., Hattori T. Blood Levelsof Galectin-9, an Immuno-Regulating Molecule, Reflect the Severity for theAcute and Chronic Infectious Diseases. Biomolecules. 2021;11:430.

2.Nishi N., Itoh A., Fujiyama A., Yoshida N., Araya S.-i., Hirashima M.,Shoji H., Nakamura T. Development of highly stable galectins: Truncation of thelinker peptide confers protease-resistance on tandem-repeat type galectins.FEBS Lett. 2005;579:2058–2064.

3.Oomizu S., Arikawa T., Niki T., Kadowaki T., Ueno M., Nishi N., Yamauchi A., HirashimaM. Galectin-9 suppresses Th17 cell development in an IL-2-dependent butTim-3-independent manner. Clin. Immunol. 2012;143:51–58. d

4.Bozorgmehr N., Mashhouri S., Perez Rosero E., Xu L., Shahbaz S., Sligl W.,Osman M., Kutsogiannis D.J., MacIntyre E., O’Neil C.R., et al. Galectin-9, aPlayer in Cytokine Release Syndrome and a Surrogate Diagnostic Biomarker inSARS-CoV-2 Infection. mBio. 2021;12:e00384-21.

Background

Galectin-9 is a β-galactoside binding lectin known for its immunomodulatory role in various microbial infections. Gal-9 is expressed in all organ systems and localized in the nucleus, cell surface, cytoplasm and the extracellular matrix. Gal-9 structurally consists of two homologous carbohydrate-recognition domains at the N- and C-terminus (NCRD and CCRD, respectively) linked by a linker peptide that is highly susceptible to proteolysis. It mediates host-pathogen interactions and regulates cell signalling via binding to its receptors. Gal-9 is involved in many physiological functions such as cell growth, differentiation, adhesion, communication and death. Gal-9 is a molecule that positively and negatively adjusts immune systems as both a contributing factor in cytokine storm and an immunosuppressive molecule inducing, for instance, T-cell exhaustion and apoptosis.


Picture

SDS-PAGE

2μg (R: reducing conditions, N: non-reducing conditions).

ELISA

Immobilized Galectin-9 His Tag, Human (Cat. No. UA010431) at 5.0μg/mL (100μL/well) can bind TIM-3/HAVCR2 Fc Chimera, Cynomolgus (Cat. No. UA010255)  with EC50 of 0.71-1.19μg/mL.