Frizzled-4/FZD4 His Tag Protein, Human
Frizzled-4/FZD4 His Tag Protein, Human
Price:
Regular price
$410 USD
Regular price
Sale price
$410 USD
Unit price
per
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details
Product Details
Product Details
Product Specification
| Species | Human |
| Synonyms | hFz4, FzE4, CD344, Frizzled 4, Fz-4, EVR1, CD344, FZD4S, FEVR, GPCR |
| Accession | Q9ULV1 |
| Amino Acid Sequence | Phe37-Glu180, with C-terminal 8*His FGDEEERRCDPIRISMCQNLGYNVTKMPNLVGHELQTDAELQLTTFTPLIQYGCSSQLQFFLCSVYVPMCTEKINIPIGPCGGMCLSVKRRCEPVLKEFGFAWPESLNCSKFPPQNDHNHMCMEGPGDEEVPLPHKTPIQPGEEGGGSHHHHHHHH |
| Expression System | HEK293 |
| Molecular Weight | 20-28kDa |
| Purity | >95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
| Reference |
1、Nallathambi J. et al. (2006) Identification of novel FZD4 mutations in Indian patients with familial exudative vitreoretinopathy. Mol Vis. 12: 1086-1092. 2、Sjöblom T. et al. (2006) The consensus coding sequences of human breast and colorectal cancers. Science. 314(5797): 268-274. |
Background
Frizzled-4, designated CD344, is a 7-transmembrane glycoprotein of the Frizzled family within the G-protein coupled receptor superfamily. Frizzled proteins function as receptors for Wnt proteins and can activate canonical Wnt/beta-catenin signaling as well as planar cell polarity and calcium flux pathways. Frizzled-4 is particularly important in angiogenic Wnt pathway signaling. Frizzled4 plays a crucial role in maintaining the integrity of the blood-brain barrier/blood-eye barrier, and regulating the expression of related proteins in the Frizzled4/Norrin pathway can regulate the switching of the blood-brain/blood-eye barrier. Frizzled-4 plays a critical role in retinal vascularization by acting as a receptor for Wnt proteins and norrin (NDP).
Picture
Picture
SDS-PAGE
2μg (R: reducing condition, N: non-reducing condition).
