Skip to product information
1 of 1

Frizzled-4/FZD4 His Tag Protein, Human

Frizzled-4/FZD4 His Tag Protein, Human

Catalog Number: UA010392 Reactivity: Human Conjugation: Unconjugated Brand: UA BIOSCIENCE
Price:
Regular price $410 USD
Regular price Sale price $410 USD
Size:

For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms hFz4, FzE4, CD344, Frizzled 4, Fz-4, EVR1, CD344, FZD4S, FEVR, GPCR
Accession Q9ULV1
Amino Acid Sequence Phe37-Glu180, with C-terminal 8*His FGDEEERRCDPIRISMCQNLGYNVTKMPNLVGHELQTDAELQLTTFTPLIQYGCSSQLQFFLCSVYVPMCTEKINIPIGPCGGMCLSVKRRCEPVLKEFGFAWPESLNCSKFPPQNDHNHMCMEGPGDEEVPLPHKTPIQPGEEGGGSHHHHHHHH
Expression System HEK293
Molecular Weight 20-28kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1、Nallathambi J. et al. (2006) Identification of novel FZD4 mutations in Indian patients with familial exudative vitreoretinopathy. Mol Vis. 12: 1086-1092.

2、Sjöblom T. et al. (2006) The consensus coding sequences of human breast and colorectal cancers. Science. 314(5797): 268-274.

Background

Frizzled-4, designated CD344, is a 7-transmembrane glycoprotein of the Frizzled family within the G-protein coupled receptor superfamily. Frizzled proteins function as receptors for Wnt proteins and can activate canonical Wnt/beta-catenin signaling as well as planar cell polarity and calcium flux pathways. Frizzled-4 is particularly important in angiogenic Wnt pathway signaling. Frizzled4 plays a crucial role in maintaining the integrity of the blood-brain barrier/blood-eye barrier, and regulating the expression of related proteins in the Frizzled4/Norrin pathway can regulate the switching of the blood-brain/blood-eye barrier. Frizzled-4 plays a critical role in retinal vascularization by acting as a receptor for Wnt proteins and norrin (NDP).

Picture

SDS-PAGE

2μg (R: reducing condition, N: non-reducing condition).