Skip to product information
1 of 1

FABP3 His Tag, Human

FABP3 His Tag, Human

Catalog Number: S0A9024 Brand: Starter
Price:
Regular price $390.00 SGD
Regular price Sale price $390.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Accession P05413
Amino Acid Sequence MHHHHHHVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHGTAVCTRTYEKEA
Expression System E.coli
Molecular Weight 15.7 kDa(Reducing)
Purity

95%,  by SDS-PAGE under reducing conditions

Endotoxin <2EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation.
Stability & Storage

· 12 months from date of receipt, -20 to -70 °C as supplied. 
· 6 months, -20 to -70 °C under sterile conditions after reconstitution.
· 1 week, 2 to 8 °C under sterile conditions after reconstitution.  
· Please avoid repeated freeze-thaw cycles.

Background

Fatty acid-binding protein 3 (FABP3) is a cytosolic protein found in various tissues, including heart, skeletal muscle, intestinal mucosa, liver, and kidney. It is also highly expressed in the adult brain, particularly in the pons, frontal lobe, and hippocampus. In the brain, FABP3 regulates the lipid composition of the membrane and transports fatty acids between different intracellular compartments. It is released extracellularly after neuronal damage and high cerebrospinal fluid (CSF) concentration of FABP3 is found in acute conditions, such as brain injury and stroke. CSF FABP3 concentration is also higher in conditions with neuro degeneration/neuronal damage, e.g., Alzheimer’s disease (AD), mild cognitive impairment (MCI) due to AD, dementia with Lewy bodies, and Creutzfeldt–Jakob disease. CSF FABP3 concentration correlates with cognitive decline and are associated with brain volume loss in areas selectively affected in early AD. Thus, FABP3 is suggested to be a general marker of neuronal damage.

 

Picture

SDS-PAGE

FABP3 His Tag, Human,1μg(R: reducing conditions, N: non-reducing conditions).

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)