Skip to product information
1 of 1

Epididymis Protein 4(HE4) His Tag Protein, Human

Epididymis Protein 4(HE4) His Tag Protein, Human

Catalog Number: UA030004 Reactivity: Human Conjugation: Unconjugated Brand: UA BIOSCIENCE
Price:
Regular price $351.00 SGD
Regular price Sale price $351.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms Epididymis 4(HE4);WAP Four-Disulfide Core Domain Protein 2, Epididymal Secretory Protein E4, Major Epididymis-Specific Protein E4, Putative Protease Inhibitor WAP5, WFDC2, HE4, WAP5
Accession Q14508
Amino Acid Sequence EKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFCSLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNFHHHHHH
Expression System HEK293
Molecular Weight major bands at 19 kDa and 22-26 kDa respectively which are due to post-translational modifications.
Purity >95%, by SDS-PAGE under reducing conditions
Endotoxin <2EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation .
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

Human epididymal protein 4 (HE4) belongs to the whey acidic 4-disulfide center (WFDC) protein family and has the characteristics of suspected trypsin inhibitors. Mature human HE4 contains 94 amino acids (aa) and consists of two core structures: a natural N-terminal glycosylated protein of about 25KDa and two core regions of whey acidic protein (WAP, which consists of four disulfide core regions and eight cysteine residues). WFDC2 / HE4 can undergo a series of complex alternative splicing events and may produce five different protein subtypes containing WAP domains. It is expressed in many normal tissues, including the male reproductive system, respiratory region and nasopharynx. It is highly expressed in ovarian, colon, breast, lung, kidney and other tumor cell lines.

Picture

SDS-PAGE

Epididymis protein 4(HE4) His Tag, Human ,3 μg on SDS-PAGE under reducing and condition. The purity is greater than 95%.

SEC-HPLC

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)