Skip to product information
1 of 1

CEACAM-8/CD66b His Tag Protein, Human

CEACAM-8/CD66b His Tag Protein, Human

Catalog Number: UA010375 Reactivity: Human Conjugation: Unconjugated Brand: UA BIOSCIENCE
Price:
Regular price $655.00 SGD
Regular price Sale price $655.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms CEACAM8, CD66b, CD67, CGM6, NCA-95
Accession P31997
Amino Acid Sequence Gln35-Asp320, with C-terminal 8*His QLTIEAVPSNAAEGKEVLLLVHNLPQDPRGYNWYKGETVDANRRIIGYVISNQQITPGPAYSNRETIYPNASLLMRNVTRNDTGSYTLQVIKLNLMSEEVTGQFSVHPETPKPSISSNNSNPVEDKDAVAFTCEPETQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLLSVTRNDVGPYECEIQNPASANFSDPVTLNVLYGPDAPTISPSDTYYHAGVNLNLSCHAASNPPSQYSWSVNGTFQQYTQKLFIPNITTKNSGSYACHTTNSATGRNRTTVRMITVSDGGGSHHHHHHHH
Expression System HEK293
Molecular Weight 50-70kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1、Yoon J. et al. (2007) CD66b regulates adhesion and activation of human eosinophils. J Immunol. 179(12): 8454-8462.

2、Skubitz K M. et al. (1996) CD6a, CD66b, CD66c, and CD66d each independently stimulate neutrophils. J Leukoc Biol. 60(1): 106-117.

3、Skubitz K M. et al. (2008) Inte rdependency of CEACAM-1, -3, -6, and -8 induced human neutrophil adhesion to endothelial cells. J Transl Med. 6: 78.

4、Lasa A. et al. (2008) High expression of CEACAM6 and CEACAM8 mRNA in acute lymphoblastic leukemias. Ann Hematol. 87(3): 205-211.

Background

Carcinoembryonic antigen-related cell adhesion molecule 8 (CEACAM-8), also known as CGM6 and CD66b, is an approximately 95 kDa member of the human carcinoembryonic antigen (CEA) family that plays a role in cell adhesion, cell migration and pathogen binding. Human CEACAM-8 is composed of a 34 amino acid (aa) signal peptide, a 29 aa propeptide segment which is removed in the mature form, and a 286 aa CEACAM-8 region containing one V-type and two C2-type Ig-like domains. CEACAM family members are widely expressed in epithelial, endothelial, and hematopoietic cells, including neutrophils, T-cells, and NK cells. CEACAMs appear to be capable of transmitting signals that result in a variety of effects depending on the tissue, including tumor suppression, tumor promotion, angiogenesis, neutrophil activation, lymphocyte activation, regulation of the cell cycle, and regulation of adhesion. CEACAMs have now been associated with numerous intracellular signaling processes including cell adhesion, cell growth, recognition and differentiation, angiogenesis, and apoptosis.

Picture

SDS-PAGE

1μg (R: reducing condition, N: non-reducing condition).

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)