CD83 His Tag Protein, Mouse

Met22-Arg133, with C-terminal 8*His MREVTVACSETADLPCTAPWDPQLSYAVSWAKVSESGTESVELPESKQNSSFEAPRRRAYSLTIQNTTICSSGTYRCALQELGGQRNLSGTVVLKVTGCPKEATESTFRKYRGGGSHHHHHHHH

25-33kDa

PBS, pH7.4

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.

· 3 months, -20 to -80℃ under sterile conditions after reconstitution.

· 1 week, 2 to 8℃ under sterile conditions after reconstitution.

· Please avoid repeated freeze-thaw cycles.

1.Carenza C., Calcaterra F., Oriolo F., Di Vito C., Ubezio M., Della Porta M.G., Mavilio D., Della Bella S. Costimulatory Molecules and Immune Checkpoints Are Differentially Expressed on Different Subsets of Dendritic Cells. Front. Immunol. 2019;10:1325.
2.Tze L.E., Horikawa K., Domaschenz H., Howard D.R., Roots C.M., Rigby R.J., Way D.A., Ohmura-Hoshino M., Ishido S., Andoniou C.E., et al. CD83 increases MHC II and CD86 on dendritic cells by opposing IL-10-driven MARCH1-mediated ubiquitination and degradation. J. Exp. Med. 2011;208:149-165.
3.Peckert-Maier K., Royzman D., Langguth P., Marosan A., Strack A., Sadeghi Shermeh A., Steinkasserer A., Zinser E., Wild A.B. Tilting the Balance: Therapeutic Prospects of CD83 as a Checkpoint Molecule Controlling Resolution of Inflammation. Int. J. Mol. Sci. 2022;23:732.