CD72 His Tag Protein, Human
CD72 His Tag Protein, Human
Price:
Regular price
$520 USD
Regular price
Sale price
$520 USD
Unit price
per
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details
Product Details
Product Details
Product Specification
| Species | Human |
| Synonyms | CD72, LYB2, CD72b, Lyb-2, Lyb2 |
| Accession | P21854 |
| Amino Acid Sequence | Arg117-Asp359, with C-terminal 8* His RYLQVSQQLQQTNRVLEVTNSSLRQQLRLKITQLGQSAEDLQGSRRELAQSQEALQVEQRAHQAAEGQLQACQADRQKTKETLQSEEQQRRALEQKLSNMENRLKPFFTCGSADTCCPSGWIMHQKSCFYISLTSKNWQESQKQCETLSSKLATFSEIYPQSHSYYFLNSLLPNGGSGNSYWTGLSSNKDWKLTDDTQRTRTYAQSSKCNKVHKTWSWWTLESESCRSSLPYICEMTAFRFPDGGGSHHHHHHHH |
| Expression System | HEK293 |
| Molecular Weight | 30-35kDa |
| Purity | >95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
| Reference |
1、Wu H J. et al. (2009) CD72, a coreceptor with both positive and negative effects on B lymphocyte development and function. J Clin Immunol. 29: 12-21. 2、Adachi T. et al. (2000) CD72 negatively regulates signaling through the antigen receptor of B cells. J Immunol. 164: 1223-1229. |
Background
CD72 is a coreceptor of B cell receptor (BCR), which is expressed on all B cells starting at the pre-B cell stage, but its expression decreases significantly during differentiation into plasma cells. CD72 is a transmembrane receptor that is expressed as a homodimer. It has a conserved intracellular domain, which contains an immunoreceptor tyrosine-based inhibitory motif (ITIM) that binds SHP-1, a tyrosine phosphatase, and an ITIM-like motif that binds Grb2, an adaptor protein required to activate the Ras pathway. CD72 is known to play an important role in various B cell processes, including proliferation, apoptosis and differentiation. Mouse CD72 negatively regulates BCR signaling by recruiting Src homology 2 domain-containing protein tyrosine phosphatase-1 (SHP-1) at ITIM.
Picture
Picture
SDS-PAGE
1μg (R: reducing conditions, N: non-reducing conditions).
