Skip to product information
1 of 1

CD72 His Tag Protein, Human

CD72 His Tag Protein, Human

Catalog Number: UA010404 Reactivity: Human Conjugation: Unconjugated Brand: UA BIOSCIENCE
Price:
Regular price $520 USD
Regular price Sale price $520 USD
Size:

For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms CD72, LYB2, CD72b, Lyb-2, Lyb2
Accession P21854
Amino Acid Sequence Arg117-Asp359, with C-terminal 8* His RYLQVSQQLQQTNRVLEVTNSSLRQQLRLKITQLGQSAEDLQGSRRELAQSQEALQVEQRAHQAAEGQLQACQADRQKTKETLQSEEQQRRALEQKLSNMENRLKPFFTCGSADTCCPSGWIMHQKSCFYISLTSKNWQESQKQCETLSSKLATFSEIYPQSHSYYFLNSLLPNGGSGNSYWTGLSSNKDWKLTDDTQRTRTYAQSSKCNKVHKTWSWWTLESESCRSSLPYICEMTAFRFPDGGGSHHHHHHHH
Expression System HEK293
Molecular Weight 30-35kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1、Wu H J. et al. (2009) CD72, a coreceptor with both positive and negative effects on B lymphocyte development and function. J Clin Immunol. 29: 12-21.

2、Adachi T. et al. (2000) CD72 negatively regulates signaling through the antigen receptor of B cells. J Immunol. 164: 1223-1229.

Background

CD72 is a coreceptor of B cell receptor (BCR), which is expressed on all B cells starting at the pre-B cell stage, but its expression decreases significantly during differentiation into plasma cells. CD72 is a transmembrane receptor that is expressed as a homodimer. It has a conserved intracellular domain, which contains an immunoreceptor tyrosine-based inhibitory motif (ITIM) that binds SHP-1, a tyrosine phosphatase, and an ITIM-like motif that binds Grb2, an adaptor protein required to activate the Ras pathway. CD72 is known to play an important role in various B cell processes, including proliferation, apoptosis and differentiation. Mouse CD72 negatively regulates BCR signaling by recruiting Src homology 2 domain-containing protein tyrosine phosphatase-1 (SHP-1) at ITIM.

Picture

SDS-PAGE

1μg (R: reducing conditions, N: non-reducing conditions).