Skip to product information
1 of 1

Canis lupus familiaris CD64, His tag

Canis lupus familiaris CD64, His tag

Catalog Number: S0A1099 Brand: Starter
Price:
Regular price $150 USD
Regular price Sale price $150 USD
Size:

For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Canis lupus familiaris
Synonyms High affinity IgG Fc gamma receptor 1, FcgammaRI
Accession Q7YQJ5
Amino Acid Sequence

Protein sequence (Q7YQJ5, Gln16-Pro288, with C-10*His) QTDPVKAVITLQPPWVSVFQEESVTLWCEGPHLPGDSSTQWFLNGTATQTLTPRYRIAAASVNDNGEYRCQTGLSVLSDPIQLGIHRDWLILQVSGRVFTEGEPLTLRCHGWNNKLVYNVLFYQNGTVLKFSPQNSEFTILKTTLHHNGIYHCSAMGKHRYESAGVSITIKELFPAPVLKASLSSPILEGHVVNLSCETKLLLQRPGLQLYFSFYMGSKTLLSRNTSSEYQILTAKKEDSGLYWCEATTEDGNVVKRSPELELQVVGPQTLTPGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 32.2 kDaObserved MW: 33, 40, 45 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

CD64 (Cluster of Differentiation 64) is a type of integral membrane glycoprotein known as an Fc receptor that binds monomeric IgG-type antibodies with high affinity. It is more commonly known as Fc-gamma receptor 1 (FcγRI). After binding IgG, CD64 interacts with an accessory chain known as the common γ chain (γ chain), which possesses an ITAM motif that is necessary for triggering cellular activation. Structurally CD64 is composed of a signal peptide that allows its transport to the surface of a cell, three extracellular immunoglobulin domains of the C2-type that it uses to bind antibody, a hydrophobic transmembrane domain, and a short cytoplasmic tail. CD64 is constitutively found on only macrophages and monocytes, but treatment of polymorphonuclear leukocytes with cytokines like IFNγ and G-CSF can induce CD64 expression on these cells.

Picture

SDS-PAGE

2 μg(R: reducing conditions)