Skip to product information
1 of 7

Angiopoietin-2(275-496) His Tag Protein, Human

Angiopoietin-2(275-496) His Tag Protein, Human

Catalog Number: UA010220 Reactivity: Human Conjugation: Unconjugated Brand: UA BIOSCIENCE
Price:
Regular price $480 USD
Regular price Sale price $480 USD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms Angiopoietin-2, ANGPT2, AGPT2, ANG2
Accession O15123
Amino Acid Sequence

Lys275-Phe496, with N-terminal 8*His

HHHHHHHHGGGSKEEQISFRDCAEVFKSGHTTNGIYTLTFPNSTEEIKAYCDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGNPSGEYWLGNEFVSQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYRIHLKGLTGTAGKISSISQPGNDFSTKDGDNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGSGYSLKATTMMIRPADF

Expression System HEK293
Molecular Weight 30-33kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1、Hu B. et al. (2009) Angiopoietin-2: development of inhibitors for cancer therapy. Curr Oncol Rep. 11(2): 111-116.

Background

Angiopoietin-2 (ANG 2, or ANGPT2), is a member of the ANG family, which plays an important role in angiogenesis during the development and growth of human cancers. Both ANGPT-1 and ANGPT-2 appear to bind to the tyrosine kinase receptor, Tie-2, found primarily on the luminal surface of endothelial cells. ANG-2's role in angiogenesis generally is considered as an antagonist for ANG1, inhibiting ANG1-promoted Tie2 signaling, which is critical for blood vessel maturation and stabilization. ANG-2 modulates angiogenesis in a cooperative manner with another important angiogenic factor, vascular endothelial growth factor A. Genetic studies have revealed that ANG-2 also is is also critical in lymphangiogenesis during development. ANG-2 has multiple physiologic effects that regulate vascular tone, hormone secretion, tissue growth and neural activity. Several reports indicate that ANG-2 can induce neovascularization in experimental systems due to the expression of different growth factors such as angiopoietin 2, vascular endothelial factor, and its receptor, fibroblast growth factor, platelet derived growth factor, transforming growth factor beta and epidermal growth factor. In addition, ANG-2 is strongly expressed in the vasculature of many tumors and it has been suggested that ANG-2 may act synergistically with other cytokines such as vascular endothelial growth factor to promote tumor-associated Angiogenesis and tumor progression.

Picture

Bioactivity

Protein A Chip captured Tie-2 Fc Chimera, Cynomolgus (Cat. No. UA010526), can bind Angiopoietin-2(275-496) His Tag, Human(Cat. No. UA010220) with an affinity constant of 0.93μM as determined in SPR assay.

Protein A Chip captured Tie-2 Fc Chimera, Human (Cat. No. UA010628), can bind Angiopoietin-2(275-496) His Tag, Human(Cat. No. UA010220) with an affinity constant of 0.75μM as determined in SPR assay.

SDS-PAGE

2μg (R: reducing conditions, N: non-reducing conditions).

ELISA

Immobilized Angiopoietin-2(275-496) His Tag, Human (Cat. No. UA010220) at 2.0μg/mL (100μL/well) can bind Tie-2 Fc Chimera, Cynomolgus (Cat. No. UA010526) with EC50 of 0.22-0.55μg/ml.

Immobilized Angiopoietin-2(275-496) His Tag, Human (Cat. No. UA010220) at 5.0μg/mL (100μL/well) can bind Tie-2 Fc Chimera, Human (Cat. No. UA010628) with EC50 of 1.00-2.09μg/ml.

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)