Skip to product information
1 of 1

VNN1/Vanin-1 His Tag Protein, Mouse

VNN1/Vanin-1 His Tag Protein, Mouse

Catalog Number: UA010535 Reactivity: Mouse Conjugation: Unconjugated Brand: UA BIOSCIENCE
Price:
Regular price $727.00 SGD
Regular price Sale price $727.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Mouse
Antigen VNN1/Vanin-1
Synonyms Pantetheinase, Tiff66, Vascular Non-Inflammatory Molecule 1
Accession Q9Z0K8
Amino Acid Sequence

Leu24-Ser487, with C-terminal 8*His LDTFLAAVYEHAVILPKDTLLPVSHSEALALMNQNLDLLEGAIVSAAKQGAHIIVTPEDGIYGVRFTRDTIYPYLEEIPDPQVNWIPCDNPKRFGSTPVQERLSCLAKNNSIYVVANMGDKKPCNTSDSHCPPDGRFQYNTDVVFDSQGKLVARYHKQNIFMGEDQFNVPMEPEFVTFDTPFGKFGVFTCFDILFHDPAVTLVTEFQVDTILFPTAWMDVLPHLAAIEFHSAWAMGMGVNFLAANLHNPSRRMTGSGIYAPDSPRVFHYDRKTQEGKLLFAQLKSHPIHSPVNWTSYASSVESTPTKTQEFQSIVFFDEFTFVELKGIKGNYTVCQNDLCCHLSYQMSEKRADEVYAFGAFDGLHTVEGQYYLQICILLKCKTTNLRTCGSSVDTAFTRFEMFSLSGTFGTRYVFPEVLLSEVKLAPGEFQVSSDGRLVSLKPTSGPVLTIGLFGRLYGKDWASGGGSHHHHHHHH

Expression System HEK293
Molecular Weight 60-72kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1. Ykelien L Boersma. The structure of vanin 1: a key enzyme linking metabolic disease and inflammation. Acta Crystallogr D Biol Crystallogr. 2014 Dec 1;70(Pt 12):3320-9. Epub 2014 Nov 28.

Background

Vanin 1, or pantetheinase, is a glycosylphosphatidylinositol(GPI)-anchored ectoenzyme that has been shown to be widely expressed in many tissues, including the liver, kidney and gut. Pantetheinase catalyzes the hydrolysis of pantetheine to pantothenic acid (vitamin B5) and cysteamine, which together with cystamine participate in the regulation of cellular pathways involved in oxidative stress and inflammation. Germline deletion of vanin 1 in mice results in an absence of tissue cysteamine. As such, vanin 1 has been shown to both protect tissues from and sensitize tissues to damage in different disease settings. Mice that lack vanin 1 display resistance to oxidative tissue damage induced by whole-body γ-irradiation, with a reduction in apoptosis and inflammation. The absence of cellular cysteamine was associated with elevated levels of the potent antioxidant glutathione.

Picture

SDS-PAGE

1μg (R: reducing condition, N: non-reducing condition).

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)