Skip to product information
1 of 4

CD47 His Tag Protein, Mouse

CD47 His Tag Protein, Mouse

Catalog Number: UA010446 Reactivity: Mouse Conjugation: Unconjugated Brand: UA BIOSCIENCE
Price:
Regular price $540 USD
Regular price Sale price $540 USD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Mouse
Antigen CD47
Synonyms MER6, IAP, OA3
Accession Q61735
Amino Acid Sequence

Gln19-Lys140, with C-terminal 8*His 
QLLFSNVNSIEFTSCNETVVIPCIVRNVEAQSTEEMFVKWKLNKSYIFIYDGNKNSTTTDQNFTSAKISVSDLINGIASLKMDKRDAMVGNYTCEVTELSREGKTVIELKNRTVSWFSPNEKGGGSHHHHHHHH

Expression System HEK293
Molecular Weight 33-43kDa (Reducing)
Purity

>95% by SDS-PAGE

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1.Brown E J. et al. (2001) Integrin-associated protein (CD47) and its ligands. Trends Cell Biol. 11(3): 130-135.

Background

CD47, also known as Integrin-associated protein (IAP), is a typical representative of the "marker of self" of targets expressed by all types of cells. CD47 is a glycoprotein with an immunoglobulin variable N-terminal domain, five transmembrane domains, and a short C-terminal intracellular tail with four variably different splicing isomers, resulting in four isoforms. CD47 is an immune cell group that plays a major role in targeted tumor immunotherapy. CD47 expressed by cancer cells interacts with SIRP-α and SIRP-γ expressed by NK cells to protect cancer cells from phagocytosis and elimination. CD47 was highly expressed in a variety of solid tumor cells and malignant hematoma cells, and its expression level was positively correlated with disease progression.

Picture

SDS-PAGE

1μg (R: reducing condition, N: non-reducing condition).

ELISA

Immobilized CD47 His Tag, Mouse (Cat. No. UA010446) at 2.0μg/mL (100μL/well) can bind SIRP-α/CD172A Fc Chimera, Mouse (Cat. No. UA010647) with EC50 of 27.10-36.13ng/mL .

SPR

Protein A Chip captured SIRP-α/CD172A Fc Chimera, Mouse(Cat. No. UA010647), can bind CD47 His Tag, Mouse (Cat. No. UA010446) with an affinity constant of 1.56μM as determined in SPR assay.

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)