Skip to product information
1 of 2

TNFSF11/RANKL Fc Chimera Protein, Human

TNFSF11/RANKL Fc Chimera Protein, Human

Catalog Number: UA010453 Reactivity: Human Conjugation: Unconjugated Brand: UA BIOSCIENCE
Price:
Regular price $1,128.00 SGD
Regular price Sale price $1,128.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Antigen TNFSF11/RANKL
Synonyms RANKL,CD254,TRANCE,OPGL,ODF
Accession O14788-2
Amino Acid Sequence

Gly63-Asp244, with N-terminal Human IgG Fc

PKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKIEGRGSQHIRAEKAMVDGSWLDLAKRSKLEAQPFAHLTINATDIPSGSHKVSLSSWYHDRGWAKISNMTFSNGKLIVNQDGFYYLYANICFRHHETSGDLATEYLQLMVYVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGFFKLRSGEEISIEVSNPSLLDPDQDATYFGAFKVRDID

Expression System HEK293
Molecular Weight

55-60kDa (Reducing)

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1.O'Brien, C.A. (2010) Bone 46, 911-9.


Background

RANKL (also known as TRANCE or OPGL) is a member of the TNF ligand superfamily. RANKL is produced by T cells, mammary epithelial cells and endothelial cells.  RANKL, through its ability to stimulate osteoclast formation and activity, is a critical mediator of bone resorption and overall bone density. RANK and RANKL are key regulators of bone remodeling and regulate T cell/dendritic cell communications, and lymph node formation.RANK-RANKL signaling not only activates a variety of downstream signaling pathways required for osteoclast development, but crosstalk with other signaling pathways also fine-tunes bone homeostasis both in normal physiology and disease.

Picture

Bioactivity

 Measured by its ability to induce osteoclast differentiation of RAW 264.7 mouse monocyte/macrophage cells.The EC50 for this effect is less than 5ng/ml.

SDS-PAGE

1μg (R: reducing condition, N: non-reducing condition).