Skip to product information
1 of 3

TNF-α Protein, Mouse

TNF-α Protein, Mouse

Catalog Number: UA040083 Reactivity: Mouse Conjugation: Unconjugated Brand: UA BIOSCIENCE
Price:
Regular price $206.00 SGD
Regular price Sale price $206.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Mouse
Synonyms TNF-α, Cachectin, Tumor Necrosis Factor-Alpha, TNFSF1A
Accession P06804
Amino Acid Sequence

Leu80-Leu235, with N-terminal 6*His MHHHHHHLRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLGGVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL

Expression System E.coli
Molecular Weight

18.2kDa

Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer 20mM Tris, 150mM NaCl, 2mM TCEP, pH8.0
Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1、Pennica D. et al. (1984) Human tumour necrosis factor: precursor structure, expression and homology to lymphotoxin. Nature. 312(5996): 724-729.

2、Nedospasov S A. et al. (1986) Tandem arrangement of genes coding for tumor necrosis factor (TNF-alpha) and lymphotoxin (TNF-beta) in the human genome. Cold Spring Harb Symp Quant Biol. 51(1): 611-624.

Background

Tumor necrosis factor α (TNF alpha) is an effective pro-inflammatory cytokine, which can kill and inhibit tumor cells. It is mainly produced by activated macrophages and can also be secreted by other types of cells, such as CD4+ lymphocytes, NK cells, neutrophils, mast cells, eosinophils and neuronal tissues. The members of TNF alpha family exert their cellular effect through two distinct surface receptors of the TNF receptor family, TNFR1and TNFR2. The pleiotropic biological effects of TNF can be attributed to its ability to simultaneously activate multiple signaling pathways in cells. TNF-induced NF-κB activation promotes the growth, invasion and metastasis of cancer cells.

Picture

Bioactivity

Measured in a cell proliferation assay using L-929 mouse fibrosarcoma cells, the EC50 for this effect is less than 80 pg/ml.

SDS-PAGE

1μg (R: reducing condition, N: non-reducing condition).

SPR

Protein A Chip captured TNFR-1/CD120a Fc Chimera, Human (Cat. No. UA040030), can bind TNF-α His Tag, Mouse (Cat. No. UA040083) with an affinity constant of 0.069nM as determined in SPR assay.