TNF-α Protein, Mouse
TNF-α Protein, Mouse
Product Details
Product Details
Product Specification
| Species | Mouse |
| Synonyms | TNF-α, Cachectin, Tumor Necrosis Factor-Alpha, TNFSF1A |
| Accession | P06804 |
| Amino Acid Sequence | Leu80-Leu235, with N-terminal 6*His MHHHHHHLRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLGGVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL |
| Expression System | E.coli |
| Molecular Weight | 18.2kDa |
| Purity | >95% by SDS-PAGE |
| Endotoxin | <1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | 20mM Tris, 150mM NaCl, 2mM TCEP, pH8.0 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
| Reference |
1、Pennica D. et al. (1984) Human tumour necrosis factor: precursor structure, expression and homology to lymphotoxin. Nature. 312(5996): 724-729. 2、Nedospasov S A. et al. (1986) Tandem arrangement of genes coding for tumor necrosis factor (TNF-alpha) and lymphotoxin (TNF-beta) in the human genome. Cold Spring Harb Symp Quant Biol. 51(1): 611-624. |
Background
Tumor necrosis factor α (TNF alpha) is an effective pro-inflammatory cytokine, which can kill and inhibit tumor cells. It is mainly produced by activated macrophages and can also be secreted by other types of cells, such as CD4+ lymphocytes, NK cells, neutrophils, mast cells, eosinophils and neuronal tissues. The members of TNF alpha family exert their cellular effect through two distinct surface receptors of the TNF receptor family, TNFR1and TNFR2. The pleiotropic biological effects of TNF can be attributed to its ability to simultaneously activate multiple signaling pathways in cells. TNF-induced NF-κB activation promotes the growth, invasion and metastasis of cancer cells.
Picture
Picture
Bioactivity
SDS-PAGE
SPR
Protein A Chip captured TNFR-1/CD120a Fc Chimera, Human (Cat. No. UA040030), can bind TNF-α His Tag, Mouse (Cat. No. UA040083) with an affinity constant of 0.069nM as determined in SPR assay.
